Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74875

Protein Details
Accession O74875    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-52ANSKDTKGLKEERKRKKRKNKYKIPPGHTQQDBasic
NLS Segment(s)
PositionSequence
27-44KGLKEERKRKKRKNKYKI
Subcellular Location(s) cyto 14.5, cyto_nucl 13.333, nucl 11, mito_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001199  Cyt_B5-like_heme/steroid-bd  
IPR036400  Cyt_B5-like_heme/steroid_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0020037  F:heme binding  
GO:0046872  F:metal ion binding  
GO:0003958  F:NADPH-hemoprotein reductase activity  
GO:0042168  P:heme metabolic process  
KEGG spo:SPCC330.03c  -  
Pfam View protein in Pfam  
PF00173  Cyt-b5  
PROSITE View protein in PROSITE  
PS50255  CYTOCHROME_B5_2  
Amino Acid Sequences MLSIFKNLLGTSEEDGTTQEANSKDTKGLKEERKRKKRKNKYKIPPGHTQQDWDALVASGKNLSGVESPISVTAEELAKHCSPDDCWMAIRGKVYNVTAYLPYHPVGPKKILKHSGVDATKPYLKHHDWVNEEELLKTSFVGYLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.15
5 0.13
6 0.15
7 0.13
8 0.16
9 0.17
10 0.18
11 0.2
12 0.24
13 0.27
14 0.28
15 0.37
16 0.44
17 0.53
18 0.62
19 0.69
20 0.76
21 0.85
22 0.9
23 0.92
24 0.94
25 0.94
26 0.95
27 0.95
28 0.95
29 0.96
30 0.95
31 0.89
32 0.88
33 0.82
34 0.79
35 0.68
36 0.59
37 0.49
38 0.44
39 0.38
40 0.28
41 0.22
42 0.14
43 0.14
44 0.11
45 0.1
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.06
53 0.07
54 0.06
55 0.07
56 0.07
57 0.07
58 0.06
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.1
65 0.1
66 0.1
67 0.11
68 0.1
69 0.11
70 0.15
71 0.16
72 0.13
73 0.14
74 0.17
75 0.18
76 0.18
77 0.19
78 0.15
79 0.14
80 0.15
81 0.15
82 0.14
83 0.13
84 0.13
85 0.14
86 0.14
87 0.15
88 0.14
89 0.14
90 0.16
91 0.17
92 0.19
93 0.21
94 0.26
95 0.31
96 0.34
97 0.42
98 0.45
99 0.45
100 0.46
101 0.47
102 0.49
103 0.46
104 0.43
105 0.37
106 0.36
107 0.37
108 0.34
109 0.34
110 0.33
111 0.33
112 0.35
113 0.39
114 0.43
115 0.43
116 0.47
117 0.47
118 0.43
119 0.42
120 0.38
121 0.33
122 0.26
123 0.22
124 0.18
125 0.14