Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Y3U0

Protein Details
Accession A0A0D1Y3U0   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
79-108VDKKSPGKLKKESPKKATKVKKIKVEESSKBasic
NLS Segment(s)
PositionSequence
81-103KKSPGKLKKESPKKATKVKKIKV
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MNLPGLNQHDTLAMAAAFCAAKVSNADIDWEKAARLMGSKSVAGARERLRVAKKKAESHDDTNGVSTCRSVSNAPVGGVDKKSPGKLKKESPKKATKVKKIKVEESSKPQRVRDDDDEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.07
5 0.06
6 0.07
7 0.06
8 0.06
9 0.08
10 0.1
11 0.1
12 0.11
13 0.14
14 0.14
15 0.15
16 0.16
17 0.15
18 0.13
19 0.12
20 0.12
21 0.1
22 0.1
23 0.09
24 0.11
25 0.12
26 0.12
27 0.12
28 0.13
29 0.15
30 0.14
31 0.18
32 0.17
33 0.21
34 0.22
35 0.25
36 0.3
37 0.36
38 0.4
39 0.44
40 0.47
41 0.49
42 0.52
43 0.55
44 0.53
45 0.5
46 0.5
47 0.44
48 0.39
49 0.33
50 0.29
51 0.22
52 0.17
53 0.13
54 0.09
55 0.08
56 0.09
57 0.08
58 0.09
59 0.13
60 0.14
61 0.14
62 0.15
63 0.16
64 0.16
65 0.17
66 0.16
67 0.16
68 0.17
69 0.2
70 0.27
71 0.31
72 0.37
73 0.44
74 0.53
75 0.6
76 0.69
77 0.75
78 0.77
79 0.81
80 0.81
81 0.84
82 0.84
83 0.84
84 0.85
85 0.83
86 0.84
87 0.81
88 0.81
89 0.81
90 0.79
91 0.76
92 0.75
93 0.78
94 0.76
95 0.74
96 0.69
97 0.68
98 0.66
99 0.66