Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P372

Protein Details
Accession Q9P372   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
77-106VCKGQIVGLKKRDRKKTKKNKKKTTSSGHTBasic
NLS Segment(s)
PositionSequence
86-99KKRDRKKTKKNKKK
Subcellular Location(s) cyto_nucl 11.833, cyto 10.5, nucl 10, mito_nucl 8.999, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005634  C:nucleus  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0045047  P:protein targeting to ER  
GO:0006617  P:SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition  
KEGG spo:SPAC19B12.09  -  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MLLSNEEFLKKLTDLLQTHQSKGTGSVYLSQKCNPVDEGEGSSASVLIRAKSGAAEKISTVVELDYFTDFFQSYAEVCKGQIVGLKKRDRKKTKKNKKKTTSSGHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.37
4 0.36
5 0.38
6 0.38
7 0.36
8 0.28
9 0.29
10 0.27
11 0.18
12 0.17
13 0.22
14 0.25
15 0.29
16 0.3
17 0.29
18 0.31
19 0.3
20 0.31
21 0.25
22 0.21
23 0.19
24 0.18
25 0.19
26 0.16
27 0.15
28 0.13
29 0.12
30 0.11
31 0.08
32 0.09
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.08
44 0.1
45 0.1
46 0.09
47 0.08
48 0.06
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.06
61 0.09
62 0.1
63 0.09
64 0.09
65 0.11
66 0.11
67 0.11
68 0.14
69 0.17
70 0.24
71 0.33
72 0.42
73 0.49
74 0.57
75 0.68
76 0.75
77 0.81
78 0.84
79 0.87
80 0.9
81 0.93
82 0.96
83 0.96
84 0.96
85 0.96
86 0.95