Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1XFF4

Protein Details
Accession A0A0D1XFF4    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRASNGRNKKGRGHVKPIRCSNCSHydrophilic
89-115REGRRIRTPPPRVRYNKDGKKINPQQAHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
85-109RVRSREGRRIRTPPPRVRYNKDGKK
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFPEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRIRTPPPRVRYNKDGKKINPQQAAKAAGAQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.77
6 0.82
7 0.84
8 0.8
9 0.73
10 0.72
11 0.69
12 0.7
13 0.69
14 0.66
15 0.63
16 0.65
17 0.68
18 0.69
19 0.71
20 0.71
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.68
27 0.68
28 0.6
29 0.52
30 0.46
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.12
38 0.1
39 0.09
40 0.08
41 0.08
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.11
54 0.14
55 0.19
56 0.2
57 0.22
58 0.24
59 0.25
60 0.25
61 0.26
62 0.24
63 0.19
64 0.19
65 0.18
66 0.19
67 0.19
68 0.21
69 0.21
70 0.28
71 0.3
72 0.31
73 0.34
74 0.39
75 0.47
76 0.53
77 0.58
78 0.61
79 0.64
80 0.69
81 0.74
82 0.75
83 0.77
84 0.78
85 0.77
86 0.79
87 0.79
88 0.79
89 0.8
90 0.81
91 0.8
92 0.8
93 0.81
94 0.75
95 0.78
96 0.8
97 0.8
98 0.78
99 0.71
100 0.68
101 0.65
102 0.65
103 0.54