Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

O74904

Protein Details
Accession O74904    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
96-118PYEQSRKTLKQIKKERYFPLRKYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0005829  C:cytosol  
GO:0022625  C:cytosolic large ribosomal subunit  
GO:0005730  C:nucleolus  
GO:0003729  F:mRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG spo:SPCC613.05c  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MALKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKDIARILTVINESNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRKTLKQIKKERYFPLRKYALKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.44
4 0.38
5 0.31
6 0.3
7 0.23
8 0.21
9 0.19
10 0.15
11 0.13
12 0.13
13 0.14
14 0.15
15 0.19
16 0.21
17 0.21
18 0.22
19 0.22
20 0.22
21 0.22
22 0.19
23 0.15
24 0.12
25 0.12
26 0.13
27 0.14
28 0.15
29 0.16
30 0.15
31 0.2
32 0.25
33 0.34
34 0.38
35 0.45
36 0.52
37 0.55
38 0.6
39 0.57
40 0.55
41 0.48
42 0.4
43 0.33
44 0.26
45 0.22
46 0.18
47 0.15
48 0.13
49 0.1
50 0.11
51 0.11
52 0.1
53 0.1
54 0.11
55 0.14
56 0.2
57 0.27
58 0.34
59 0.37
60 0.39
61 0.39
62 0.46
63 0.43
64 0.45
65 0.44
66 0.45
67 0.53
68 0.6
69 0.66
70 0.64
71 0.65
72 0.64
73 0.67
74 0.67
75 0.65
76 0.64
77 0.62
78 0.64
79 0.71
80 0.68
81 0.63
82 0.6
83 0.6
84 0.61
85 0.56
86 0.51
87 0.49
88 0.5
89 0.54
90 0.57
91 0.55
92 0.57
93 0.66
94 0.74
95 0.77
96 0.8
97 0.81
98 0.82
99 0.85
100 0.79
101 0.79
102 0.78