Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O43089

Protein Details
Accession O43089    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
83-103LTQIRRKEEKAPLWKRLFKRKBasic
NLS Segment(s)
PositionSequence
87-103RRKEEKAPLWKRLFKRK
Subcellular Location(s) nucl 15, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR037653  Cbp6  
IPR046827  UQCC2/CBP6  
Gene Ontology GO:0061671  C:Cbp3p-Cbp6 complex  
GO:0005759  C:mitochondrial matrix  
GO:0005739  C:mitochondrion  
GO:0043022  F:ribosome binding  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
GO:0006397  P:mRNA processing  
KEGG spo:SPBC947.14c  -  
Pfam View protein in Pfam  
PF20180  UQCC2_CBP6  
Amino Acid Sequences MSLNQKITKAVALWPKDELRPWLSFPKTLDTSIRARLQKMPPQQANKQLNALNNLLDNVYWNKYIPKQVVLKPQFKPSYYESLTQIRRKEEKAPLWKRLFKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.35
5 0.33
6 0.29
7 0.29
8 0.31
9 0.36
10 0.35
11 0.36
12 0.35
13 0.38
14 0.35
15 0.34
16 0.33
17 0.28
18 0.3
19 0.32
20 0.37
21 0.32
22 0.31
23 0.37
24 0.41
25 0.45
26 0.49
27 0.52
28 0.52
29 0.56
30 0.59
31 0.61
32 0.59
33 0.53
34 0.49
35 0.42
36 0.38
37 0.35
38 0.31
39 0.21
40 0.17
41 0.16
42 0.13
43 0.1
44 0.09
45 0.08
46 0.09
47 0.09
48 0.1
49 0.12
50 0.14
51 0.19
52 0.19
53 0.23
54 0.27
55 0.32
56 0.42
57 0.46
58 0.51
59 0.49
60 0.56
61 0.55
62 0.5
63 0.49
64 0.43
65 0.46
66 0.42
67 0.42
68 0.37
69 0.42
70 0.48
71 0.49
72 0.49
73 0.48
74 0.5
75 0.5
76 0.55
77 0.55
78 0.58
79 0.64
80 0.68
81 0.71
82 0.75
83 0.8