Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1X8K6

Protein Details
Accession A0A0D1X8K6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-92ATRAALKLQCRRRRQPRTASRPQMGGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences RRSGAACQHHGRSVVAMSQNNQSPPTAGPVDSQPSITQASPSQTSLPSAPTKIPATPSTSLASPLLATRAALKLQCRRRRQPRTASRPQMGGLRSSQSPRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.26
4 0.24
5 0.28
6 0.31
7 0.3
8 0.29
9 0.25
10 0.21
11 0.19
12 0.22
13 0.18
14 0.16
15 0.16
16 0.17
17 0.21
18 0.2
19 0.2
20 0.15
21 0.16
22 0.17
23 0.16
24 0.14
25 0.12
26 0.14
27 0.15
28 0.16
29 0.15
30 0.13
31 0.15
32 0.14
33 0.15
34 0.14
35 0.14
36 0.13
37 0.15
38 0.16
39 0.15
40 0.17
41 0.16
42 0.19
43 0.2
44 0.21
45 0.2
46 0.19
47 0.19
48 0.17
49 0.15
50 0.11
51 0.1
52 0.09
53 0.07
54 0.07
55 0.08
56 0.09
57 0.1
58 0.12
59 0.17
60 0.25
61 0.35
62 0.45
63 0.52
64 0.61
65 0.71
66 0.79
67 0.84
68 0.86
69 0.87
70 0.89
71 0.91
72 0.9
73 0.83
74 0.75
75 0.67
76 0.62
77 0.52
78 0.45
79 0.37
80 0.32
81 0.31