Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

P05476

Protein Details
Accession P05476    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-62YIVEKLKEEKPKKKRNAPKIPLNKQCTKHydrophilic
NLS Segment(s)
PositionSequence
40-53LKEEKPKKKRNAPK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MANKQAEKLITAIKKDYLKEIIKKIEELDIDKKDYIVEKLKEEKPKKKRNAPKIPLNKQCTKETASKGKCTVAACYNHICWAHMNKTQRNEYRLLKSVDIKTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.37
4 0.36
5 0.39
6 0.42
7 0.47
8 0.48
9 0.46
10 0.46
11 0.42
12 0.39
13 0.34
14 0.32
15 0.32
16 0.28
17 0.29
18 0.28
19 0.27
20 0.23
21 0.23
22 0.22
23 0.23
24 0.22
25 0.23
26 0.31
27 0.36
28 0.45
29 0.5
30 0.57
31 0.6
32 0.68
33 0.73
34 0.76
35 0.81
36 0.82
37 0.87
38 0.84
39 0.84
40 0.84
41 0.85
42 0.84
43 0.81
44 0.76
45 0.69
46 0.64
47 0.57
48 0.5
49 0.47
50 0.44
51 0.48
52 0.45
53 0.45
54 0.44
55 0.43
56 0.43
57 0.37
58 0.35
59 0.3
60 0.3
61 0.29
62 0.31
63 0.3
64 0.31
65 0.3
66 0.27
67 0.24
68 0.27
69 0.3
70 0.32
71 0.39
72 0.41
73 0.48
74 0.57
75 0.6
76 0.57
77 0.58
78 0.6
79 0.6
80 0.61
81 0.58
82 0.52
83 0.54