Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A5D7

Protein Details
Accession A0A0D2A5D7   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
220-242KKSGKKGYYKSLQQARRKARKGGBasic
NLS Segment(s)
PositionSequence
104-104K
113-117RREKK
220-242KKSGKKGYYKSLQQARRKARKGG
Subcellular Location(s) nucl 18.5, cyto_nucl 13.333, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MDFDDSSRTLSAGSIVSEETLVPEEQDDLSDEQIDFLLHRASLRMKGQNGALVTAQGPSSTRLPTLKAASELPRPYTSMVGGVAKVVEAKSVSEELRRMAEKPKRIEDPVALRREKKEPKPVLSDWYNLPRTNLTTELKRDLQLLNMRSVLDPKRMYRKQGKFKVPEYSQVGVVVEGPTEFYSARIENKQRKQTFVEEVLAGEKESGRFKSKYEELQAVKKSGKKGYYKSLQQARRKARKGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.1
6 0.09
7 0.1
8 0.1
9 0.09
10 0.09
11 0.1
12 0.1
13 0.1
14 0.12
15 0.11
16 0.11
17 0.13
18 0.12
19 0.11
20 0.11
21 0.11
22 0.09
23 0.09
24 0.09
25 0.08
26 0.08
27 0.1
28 0.12
29 0.18
30 0.23
31 0.28
32 0.28
33 0.3
34 0.31
35 0.33
36 0.31
37 0.27
38 0.21
39 0.16
40 0.15
41 0.13
42 0.12
43 0.09
44 0.09
45 0.1
46 0.12
47 0.12
48 0.14
49 0.14
50 0.16
51 0.2
52 0.23
53 0.22
54 0.22
55 0.24
56 0.26
57 0.31
58 0.31
59 0.3
60 0.28
61 0.27
62 0.26
63 0.24
64 0.21
65 0.15
66 0.15
67 0.12
68 0.11
69 0.1
70 0.09
71 0.07
72 0.08
73 0.07
74 0.06
75 0.05
76 0.05
77 0.07
78 0.09
79 0.09
80 0.11
81 0.11
82 0.12
83 0.15
84 0.15
85 0.15
86 0.22
87 0.27
88 0.32
89 0.36
90 0.4
91 0.41
92 0.41
93 0.42
94 0.38
95 0.42
96 0.42
97 0.44
98 0.41
99 0.39
100 0.4
101 0.46
102 0.5
103 0.47
104 0.49
105 0.48
106 0.51
107 0.56
108 0.54
109 0.52
110 0.46
111 0.42
112 0.34
113 0.36
114 0.34
115 0.28
116 0.28
117 0.22
118 0.22
119 0.22
120 0.23
121 0.18
122 0.19
123 0.21
124 0.25
125 0.25
126 0.24
127 0.24
128 0.2
129 0.23
130 0.25
131 0.24
132 0.22
133 0.21
134 0.21
135 0.2
136 0.24
137 0.21
138 0.21
139 0.22
140 0.24
141 0.34
142 0.35
143 0.42
144 0.49
145 0.57
146 0.61
147 0.69
148 0.74
149 0.7
150 0.72
151 0.75
152 0.66
153 0.63
154 0.58
155 0.5
156 0.41
157 0.36
158 0.32
159 0.22
160 0.22
161 0.14
162 0.08
163 0.06
164 0.07
165 0.06
166 0.07
167 0.07
168 0.07
169 0.09
170 0.11
171 0.15
172 0.21
173 0.3
174 0.39
175 0.48
176 0.58
177 0.58
178 0.61
179 0.61
180 0.6
181 0.59
182 0.53
183 0.47
184 0.37
185 0.35
186 0.32
187 0.28
188 0.22
189 0.15
190 0.12
191 0.12
192 0.15
193 0.17
194 0.21
195 0.22
196 0.23
197 0.31
198 0.36
199 0.41
200 0.43
201 0.49
202 0.48
203 0.55
204 0.58
205 0.54
206 0.53
207 0.5
208 0.5
209 0.48
210 0.52
211 0.51
212 0.54
213 0.6
214 0.65
215 0.68
216 0.73
217 0.76
218 0.78
219 0.79
220 0.83
221 0.84
222 0.85