Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O74859

Protein Details
Accession O74859    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
22-41VEDIPKKYRKQSFRDNLKVYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 10.5, cyto_mito 6.5, mito 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
IPR032566  Znf-C2HE  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0033699  F:DNA 5'-adenosine monophosphate hydrolase activity  
GO:0120108  F:DNA-3'-diphospho-5'-guanosine diphosphatase  
GO:0003690  F:double-stranded DNA binding  
GO:0003725  F:double-stranded RNA binding  
GO:0019002  F:GMP binding  
GO:1905108  F:guanosine binding  
GO:0030983  F:mismatched DNA binding  
GO:1990165  F:single-strand break-containing DNA binding  
GO:0003697  F:single-stranded DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006298  P:mismatch repair  
GO:0000012  P:single strand break repair  
KEGG spo:SPCC18.09c  -  
Pfam View protein in Pfam  
PF01230  HIT  
PF16278  zf-C2HE  
Amino Acid Sequences MSVHKTNDAFKVLMNSAKEPIVEDIPKKYRKQSFRDNLKVYIESPESYKNVIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPLEIMMKHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGTLTSLFQEDLKCWRCGETFGRHFTKLKAHLQEEYDDWLDKSVSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.26
4 0.27
5 0.25
6 0.21
7 0.22
8 0.23
9 0.24
10 0.24
11 0.31
12 0.38
13 0.45
14 0.46
15 0.52
16 0.56
17 0.61
18 0.67
19 0.7
20 0.72
21 0.77
22 0.84
23 0.79
24 0.74
25 0.7
26 0.63
27 0.52
28 0.47
29 0.38
30 0.29
31 0.27
32 0.26
33 0.24
34 0.23
35 0.23
36 0.18
37 0.17
38 0.18
39 0.18
40 0.16
41 0.16
42 0.15
43 0.15
44 0.14
45 0.14
46 0.13
47 0.11
48 0.09
49 0.11
50 0.11
51 0.12
52 0.14
53 0.15
54 0.17
55 0.22
56 0.23
57 0.21
58 0.25
59 0.25
60 0.29
61 0.32
62 0.31
63 0.27
64 0.27
65 0.25
66 0.23
67 0.25
68 0.2
69 0.19
70 0.18
71 0.18
72 0.17
73 0.17
74 0.19
75 0.17
76 0.19
77 0.17
78 0.15
79 0.15
80 0.17
81 0.18
82 0.15
83 0.16
84 0.16
85 0.14
86 0.15
87 0.16
88 0.15
89 0.14
90 0.13
91 0.1
92 0.08
93 0.07
94 0.06
95 0.05
96 0.04
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.05
103 0.05
104 0.06
105 0.06
106 0.07
107 0.08
108 0.09
109 0.09
110 0.13
111 0.14
112 0.14
113 0.14
114 0.13
115 0.14
116 0.12
117 0.12
118 0.08
119 0.09
120 0.09
121 0.09
122 0.12
123 0.11
124 0.11
125 0.13
126 0.13
127 0.11
128 0.13
129 0.14
130 0.12
131 0.12
132 0.12
133 0.12
134 0.11
135 0.11
136 0.09
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.07
143 0.08
144 0.08
145 0.09
146 0.13
147 0.12
148 0.13
149 0.15
150 0.18
151 0.19
152 0.19
153 0.2
154 0.19
155 0.21
156 0.2
157 0.2
158 0.17
159 0.17
160 0.17
161 0.15
162 0.13
163 0.14
164 0.19
165 0.18
166 0.21
167 0.22
168 0.26
169 0.28
170 0.28
171 0.27
172 0.24
173 0.25
174 0.24
175 0.23
176 0.2
177 0.2
178 0.22
179 0.23
180 0.21
181 0.19
182 0.19
183 0.19
184 0.26
185 0.27
186 0.25
187 0.24
188 0.26
189 0.25
190 0.3
191 0.34
192 0.36
193 0.39
194 0.46
195 0.51
196 0.51
197 0.52
198 0.5
199 0.53
200 0.5
201 0.52
202 0.52
203 0.5
204 0.52
205 0.53
206 0.52
207 0.45
208 0.43
209 0.37
210 0.29
211 0.26
212 0.23