FuNGI

A0A0D2A0C8

Protein Details

Accession

A0A0D2A0C8

Localization Confidence

Medium

Confidence Score

14.1

NoLS Segment(s)

Position	Sequence	Protein Nature
200-221	VGRVQKKREKEASKRRRLLREA	Basic
464-484	QGSPRKVRGTESPKKQRQLEL	Hydrophilic

NLS Segment(s)

Position	Sequence
193-193	K
196-217	SQRLVGRVQKKREKEASKRRRL

Subcellular Location(s)

plas 15, nucl 6, E.R. 3, mito 1, cyto 1, golg 1, cyto_mito 1

Family & Domain DBs

InterPro	View protein in InterPro IPR040202 Brl1/Brr6 IPR018767 Brl1/Brr6_dom
Gene Ontology	GO:0031965 C:nuclear membrane GO:0055088 P:lipid homeostasis GO:0006998 P:nuclear envelope organization
Pfam	View protein in Pfam PF10104 Brr6_like_C_C

Amino Acid Sequences

MAERNHYAQPMDFEYENKRGAVDPSSPFISSLQHSSSFSASQGDLGPTWRLQSEIDQRKTNSQKRPFAQYESPLKKTETPALRPPGAGQSVLFSQPQLDTNKKLPPKPSDAATLWTTPRKSSQLVDFSSGGETPDTENWKADSEATPETTPSMGLSKGFAKLFGSGSKKNGSKAKELISVSKGSPTAGKGEIKPYSQRLVGRVQKKREKEASKRRRLLREAVDSETEADTDVEQKKAKPAAKQGFDVGGFFHYLESHPHLPHVLSFYAQLALNVFLIFGIMYILYSFWSTIRSDVDKKAQEAMAEVLAEIAVCAKHWKDNQCERGTVLPALEAVCREWEKCMNKDHRSIGRARVSAHTFAEIFNSFIEPISWKAMGFTVVVLVFCFAITNATFSLFRRNTDAHPNPFNPSMPQVPPTPQRHPSWEMQPQYGFTPYSSQYGLPPPQWGQPPGLEPAPSQGSLGSQGSPRKVRGTESPKKQRQLEL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.32
2	0.36
3	0.36
4	0.31
5	0.28
6	0.25
7	0.27
8	0.29
9	0.28
10	0.26
11	0.29
12	0.31
13	0.31
14	0.3
15	0.28
16	0.27
17	0.23
18	0.25
19	0.23
20	0.24
21	0.25
22	0.26
23	0.27
24	0.25
25	0.23
26	0.21
27	0.18
28	0.17
29	0.17
30	0.17
31	0.15
32	0.17
33	0.18
34	0.16
35	0.18
36	0.16
37	0.15
38	0.15
39	0.22
40	0.31
41	0.39
42	0.45
43	0.49
44	0.51
45	0.6
46	0.69
47	0.69
48	0.69
49	0.68
50	0.72
51	0.7
52	0.78
53	0.73
54	0.7
55	0.68
56	0.66
57	0.67
58	0.65
59	0.65
60	0.57
61	0.55
62	0.53
63	0.5
64	0.5
65	0.47
66	0.46
67	0.51
68	0.56
69	0.54
70	0.5
71	0.48
72	0.46
73	0.39
74	0.34
75	0.25
76	0.2
77	0.21
78	0.22
79	0.2
80	0.13
81	0.13
82	0.14
83	0.18
84	0.21
85	0.22
86	0.25
87	0.29
88	0.38
89	0.42
90	0.45
91	0.48
92	0.5
93	0.54
94	0.53
95	0.52
96	0.51
97	0.46
98	0.46
99	0.41
100	0.38
101	0.33
102	0.35
103	0.33
104	0.28
105	0.31
106	0.3
107	0.3
108	0.29
109	0.34
110	0.36
111	0.37
112	0.39
113	0.35
114	0.32
115	0.31
116	0.28
117	0.2
118	0.13
119	0.12
120	0.1
121	0.13
122	0.17
123	0.17
124	0.17
125	0.18
126	0.19
127	0.19
128	0.19
129	0.17
130	0.17
131	0.18
132	0.2
133	0.19
134	0.17
135	0.18
136	0.16
137	0.14
138	0.11
139	0.1
140	0.08
141	0.08
142	0.1
143	0.1
144	0.14
145	0.14
146	0.13
147	0.13
148	0.14
149	0.15
150	0.19
151	0.23
152	0.22
153	0.25
154	0.31
155	0.31
156	0.34
157	0.38
158	0.36
159	0.36
160	0.38
161	0.39
162	0.4
163	0.39
164	0.38
165	0.35
166	0.34
167	0.29
168	0.27
169	0.23
170	0.17
171	0.18
172	0.15
173	0.15
174	0.16
175	0.18
176	0.16
177	0.22
178	0.24
179	0.24
180	0.26
181	0.26
182	0.26
183	0.26
184	0.27
185	0.24
186	0.3
187	0.36
188	0.42
189	0.46
190	0.53
191	0.57
192	0.59
193	0.64
194	0.65
195	0.66
196	0.68
197	0.72
198	0.75
199	0.78
200	0.83
201	0.82
202	0.81
203	0.75
204	0.72
205	0.69
206	0.66
207	0.59
208	0.53
209	0.47
210	0.39
211	0.36
212	0.28
213	0.2
214	0.12
215	0.09
216	0.07
217	0.1
218	0.11
219	0.12
220	0.12
221	0.13
222	0.16
223	0.22
224	0.25
225	0.24
226	0.32
227	0.38
228	0.4
229	0.41
230	0.38
231	0.34
232	0.32
233	0.28
234	0.19
235	0.11
236	0.09
237	0.08
238	0.07
239	0.05
240	0.06
241	0.07
242	0.11
243	0.14
244	0.13
245	0.14
246	0.14
247	0.14
248	0.14
249	0.15
250	0.11
251	0.09
252	0.09
253	0.09
254	0.1
255	0.1
256	0.09
257	0.07
258	0.07
259	0.07
260	0.07
261	0.06
262	0.04
263	0.04
264	0.04
265	0.03
266	0.03
267	0.02
268	0.02
269	0.03
270	0.03
271	0.03
272	0.04
273	0.04
274	0.04
275	0.06
276	0.06
277	0.08
278	0.1
279	0.14
280	0.17
281	0.2
282	0.27
283	0.28
284	0.29
285	0.3
286	0.29
287	0.25
288	0.23
289	0.21
290	0.14
291	0.12
292	0.1
293	0.07
294	0.06
295	0.06
296	0.04
297	0.04
298	0.03
299	0.03
300	0.05
301	0.06
302	0.11
303	0.16
304	0.22
305	0.31
306	0.4
307	0.49
308	0.5
309	0.51
310	0.47
311	0.46
312	0.43
313	0.34
314	0.25
315	0.16
316	0.14
317	0.14
318	0.13
319	0.09
320	0.08
321	0.1
322	0.11
323	0.11
324	0.13
325	0.2
326	0.24
327	0.28
328	0.36
329	0.42
330	0.46
331	0.52
332	0.58
333	0.57
334	0.56
335	0.57
336	0.56
337	0.54
338	0.51
339	0.47
340	0.46
341	0.42
342	0.41
343	0.38
344	0.31
345	0.24
346	0.22
347	0.23
348	0.18
349	0.15
350	0.12
351	0.12
352	0.1
353	0.1
354	0.11
355	0.09
356	0.1
357	0.13
358	0.13
359	0.12
360	0.12
361	0.13
362	0.13
363	0.12
364	0.1
365	0.09
366	0.09
367	0.09
368	0.08
369	0.08
370	0.07
371	0.06
372	0.07
373	0.04
374	0.06
375	0.06
376	0.08
377	0.08
378	0.1
379	0.11
380	0.12
381	0.23
382	0.22
383	0.23
384	0.27
385	0.29
386	0.31
387	0.41
388	0.49
389	0.45
390	0.51
391	0.52
392	0.51
393	0.51
394	0.49
395	0.4
396	0.37
397	0.36
398	0.3
399	0.31
400	0.29
401	0.33
402	0.41
403	0.46
404	0.49
405	0.5
406	0.52
407	0.56
408	0.59
409	0.58
410	0.59
411	0.6
412	0.57
413	0.55
414	0.52
415	0.47
416	0.44
417	0.4
418	0.32
419	0.24
420	0.25
421	0.22
422	0.23
423	0.23
424	0.21
425	0.22
426	0.29
427	0.32
428	0.29
429	0.32
430	0.31
431	0.36
432	0.41
433	0.39
434	0.35
435	0.34
436	0.35
437	0.35
438	0.35
439	0.3
440	0.25
441	0.29
442	0.29
443	0.26
444	0.23
445	0.19
446	0.18
447	0.21
448	0.22
449	0.18
450	0.2
451	0.25
452	0.32
453	0.36
454	0.38
455	0.4
456	0.41
457	0.43
458	0.49
459	0.54
460	0.57
461	0.63
462	0.72
463	0.75
464	0.81

A0A0D2A0C8

3D AlphaFold-predicted Structure Viewer