Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2AL22

Protein Details
Accession A0A0D2AL22    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77LAKLRRKSSKYKPGTRISRVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_nucl 12.5, nucl 7, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008576  MeTrfase_NTM1  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008276  F:protein methyltransferase activity  
GO:0006480  P:N-terminal protein amino acid methylation  
Pfam View protein in Pfam  
PF05891  Methyltransf_PK  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MAGMDVDVDESISPPADESIDQKAAIQYWSSVSADNAGVLGGYPQVSRVDLQGNATFLAKLRRKSSKYKPGTRISRVVDCGAGIGRVTAGFLSKVADVVDIVEPVKQLTDVITEGESFKEIRDRGGIGKVYNVGLEEWTPEVTYDIIWTQWCLGQLTDAQLIDFFSRAKCHVHEGGWIVVKENMSTDAKGNDIFDATDSSITRTDAKFRQIFEKAGLKIVATEIQRGMPKELFPVRSYALQPRAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.12
6 0.18
7 0.19
8 0.19
9 0.2
10 0.21
11 0.21
12 0.21
13 0.19
14 0.13
15 0.13
16 0.16
17 0.15
18 0.14
19 0.13
20 0.15
21 0.14
22 0.13
23 0.11
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.06
32 0.07
33 0.08
34 0.09
35 0.1
36 0.13
37 0.13
38 0.17
39 0.17
40 0.17
41 0.17
42 0.17
43 0.16
44 0.14
45 0.22
46 0.23
47 0.26
48 0.31
49 0.4
50 0.44
51 0.54
52 0.63
53 0.65
54 0.71
55 0.76
56 0.79
57 0.8
58 0.84
59 0.8
60 0.77
61 0.7
62 0.66
63 0.58
64 0.5
65 0.4
66 0.31
67 0.26
68 0.19
69 0.14
70 0.08
71 0.06
72 0.05
73 0.04
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.05
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.04
95 0.04
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.09
107 0.09
108 0.1
109 0.1
110 0.11
111 0.12
112 0.16
113 0.17
114 0.13
115 0.14
116 0.14
117 0.13
118 0.12
119 0.11
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.08
139 0.08
140 0.08
141 0.08
142 0.09
143 0.11
144 0.12
145 0.11
146 0.1
147 0.09
148 0.1
149 0.09
150 0.09
151 0.07
152 0.06
153 0.08
154 0.1
155 0.12
156 0.12
157 0.17
158 0.2
159 0.2
160 0.23
161 0.24
162 0.26
163 0.27
164 0.26
165 0.22
166 0.21
167 0.2
168 0.17
169 0.15
170 0.15
171 0.13
172 0.14
173 0.15
174 0.13
175 0.14
176 0.15
177 0.15
178 0.12
179 0.11
180 0.1
181 0.09
182 0.11
183 0.1
184 0.12
185 0.12
186 0.13
187 0.14
188 0.15
189 0.18
190 0.17
191 0.23
192 0.25
193 0.33
194 0.34
195 0.35
196 0.42
197 0.42
198 0.43
199 0.42
200 0.45
201 0.38
202 0.39
203 0.37
204 0.29
205 0.26
206 0.26
207 0.25
208 0.18
209 0.2
210 0.17
211 0.21
212 0.25
213 0.26
214 0.29
215 0.26
216 0.26
217 0.31
218 0.36
219 0.36
220 0.33
221 0.35
222 0.34
223 0.36
224 0.39
225 0.4