Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1Z1U0

Protein Details
Accession A0A0D1Z1U0   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
106-138LPPLYASEKKKSKRRSSKTKKRPSNKLTPISESHydrophilic
NLS Segment(s)
PositionSequence
114-129KKKSKRRSSKTKKRPS
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MYFDMDFKSSPSPSASSPPISIGWPSASSATSYSSRSASSATSASQSMTCAYPSWTGFSPSATPNAFISDEDLFPDELLDGASPLLSEAPAPPRDIPFPTAMPMPLPPLYASEKKKSKRRSSKTKKRPSNKLTPISESPEVSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.28
4 0.28
5 0.28
6 0.26
7 0.25
8 0.24
9 0.19
10 0.18
11 0.16
12 0.16
13 0.14
14 0.14
15 0.13
16 0.13
17 0.15
18 0.15
19 0.16
20 0.16
21 0.16
22 0.16
23 0.16
24 0.16
25 0.13
26 0.13
27 0.13
28 0.12
29 0.12
30 0.12
31 0.12
32 0.12
33 0.11
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.12
40 0.12
41 0.15
42 0.14
43 0.16
44 0.16
45 0.16
46 0.17
47 0.15
48 0.18
49 0.15
50 0.15
51 0.13
52 0.15
53 0.14
54 0.12
55 0.13
56 0.11
57 0.1
58 0.1
59 0.1
60 0.08
61 0.08
62 0.08
63 0.05
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.09
77 0.1
78 0.12
79 0.13
80 0.15
81 0.17
82 0.19
83 0.2
84 0.18
85 0.18
86 0.18
87 0.18
88 0.17
89 0.16
90 0.15
91 0.16
92 0.14
93 0.14
94 0.12
95 0.14
96 0.2
97 0.27
98 0.31
99 0.37
100 0.45
101 0.52
102 0.61
103 0.69
104 0.74
105 0.78
106 0.84
107 0.87
108 0.89
109 0.93
110 0.95
111 0.96
112 0.95
113 0.94
114 0.95
115 0.92
116 0.92
117 0.91
118 0.89
119 0.83
120 0.8
121 0.74
122 0.71
123 0.65