Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ACF2

Protein Details
Accession A0A0D2ACF2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
88-111SVPTTPKTPGRRGRPKRKVDDGDABasic
NLS Segment(s)
PositionSequence
94-121KTPGRRGRPKRKVDDGDASPKKKPRGKK
Subcellular Location(s) cyto 14.5, cyto_nucl 14, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MPPFSFKKAKETASLNDKEIERFAIMYMIMAEEIKPTSKQYELAAGEADNTVASFKILFSTTLKKLREKNCYFEDRAEGEDGVADAASVPTTPKTPGRRGRPKRKVDDGDASPKKKPRGKKGDDGALEDAEGEAGLTATEDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.47
4 0.45
5 0.4
6 0.36
7 0.3
8 0.21
9 0.18
10 0.16
11 0.13
12 0.11
13 0.1
14 0.09
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.07
21 0.08
22 0.09
23 0.1
24 0.12
25 0.13
26 0.15
27 0.14
28 0.21
29 0.21
30 0.21
31 0.2
32 0.17
33 0.17
34 0.15
35 0.14
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.07
46 0.09
47 0.14
48 0.19
49 0.25
50 0.27
51 0.3
52 0.37
53 0.43
54 0.52
55 0.49
56 0.51
57 0.5
58 0.53
59 0.5
60 0.44
61 0.4
62 0.31
63 0.29
64 0.24
65 0.18
66 0.13
67 0.12
68 0.1
69 0.07
70 0.05
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.07
80 0.14
81 0.2
82 0.29
83 0.38
84 0.48
85 0.59
86 0.69
87 0.79
88 0.83
89 0.87
90 0.87
91 0.88
92 0.84
93 0.79
94 0.77
95 0.72
96 0.72
97 0.7
98 0.65
99 0.6
100 0.59
101 0.61
102 0.59
103 0.62
104 0.63
105 0.66
106 0.71
107 0.75
108 0.78
109 0.8
110 0.76
111 0.72
112 0.64
113 0.53
114 0.45
115 0.34
116 0.25
117 0.15
118 0.12
119 0.07
120 0.04
121 0.03
122 0.03
123 0.04