FuNGI

A0A0D2AUA5

Protein Details

Accession

A0A0D2AUA5

Localization Confidence

Medium

Confidence Score

12.1

NoLS Segment(s)

Position	Sequence	Protein Nature
530-563	RERDRERDRERDRERDRDRERRRTPPPSRMYGRD	Basic

NLS Segment(s)

Position	Sequence
529-559	DRERDRERDRERDRERDRDRERRRTPPPSRM

Subcellular Location(s)

nucl 15.5, cyto_nucl 13, cyto 9.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036915 Cyclin-like_sf IPR043198 Cyclin/Ssn8
Gene Ontology	GO:0016538 F:cyclin-dependent protein serine/threonine kinase regulator activity GO:0006357 P:regulation of transcription by RNA polymerase II

Amino Acid Sequences

MSPGVLVPRNAGIKIRGVEDEPPLVDVPAPDKSKIVVASQYLFQHDLEAVGMMDERDVQGRLQGIQIIEASRKCLRMPMKTYGTACVFFMRYRYHIATKGVDDEIAGRYDFRDVALASLWLASKAEETPKKSKEILCAFRNSTLQPEEHLTPDDEMFENQAKLMINLERYLLEIVAFDFRARNCAELLAGVMVDRDATGRVIKIAMAVVLDIYRTLAVLKQTRQTLALSCFELAARFVQSEEDIGKATNEELYVRLGTTRQEVLETLFDLIELYLNHHVVTAAGSKYTINDFMRVSTALRSEMKTKGYSRYTYLQELPPSSSPTTSPAHTDAKSTPTLLGTPRTPVNRDIDRRESLKKRLSPKENSKIFVDERDIEIGKPVSPPPSFLLTRESNGYGTQSPTSPTSPTTAEASNPDDPSQVKEVVRFVLDASRARDEDLLRRPFHHIETVEVTQQRDVWIPNDGSAQFEITSTSPASPPHMGKMRNGDVEMRDAPAVSAPSRSRTFRDIRYLGPRFDQDRDRERDDRGDRERDRERDRERDRERDRDRERRRTPPPSRMYGRDERYGRRDDRGW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.3
3	0.27
4	0.26
5	0.29
6	0.3
7	0.31
8	0.25
9	0.25
10	0.22
11	0.21
12	0.19
13	0.17
14	0.17
15	0.21
16	0.24
17	0.22
18	0.22
19	0.23
20	0.27
21	0.27
22	0.27
23	0.24
24	0.24
25	0.26
26	0.3
27	0.31
28	0.29
29	0.29
30	0.26
31	0.23
32	0.19
33	0.17
34	0.13
35	0.12
36	0.09
37	0.08
38	0.08
39	0.06
40	0.07
41	0.07
42	0.07
43	0.08
44	0.09
45	0.09
46	0.11
47	0.13
48	0.13
49	0.14
50	0.16
51	0.15
52	0.15
53	0.17
54	0.16
55	0.18
56	0.18
57	0.22
58	0.22
59	0.23
60	0.22
61	0.28
62	0.32
63	0.38
64	0.43
65	0.48
66	0.51
67	0.55
68	0.56
69	0.55
70	0.52
71	0.43
72	0.38
73	0.32
74	0.27
75	0.22
76	0.25
77	0.23
78	0.22
79	0.28
80	0.31
81	0.32
82	0.35
83	0.38
84	0.38
85	0.36
86	0.38
87	0.32
88	0.27
89	0.23
90	0.2
91	0.18
92	0.16
93	0.14
94	0.1
95	0.1
96	0.12
97	0.12
98	0.1
99	0.11
100	0.09
101	0.1
102	0.11
103	0.11
104	0.09
105	0.1
106	0.1
107	0.08
108	0.08
109	0.07
110	0.08
111	0.1
112	0.18
113	0.22
114	0.28
115	0.36
116	0.39
117	0.43
118	0.46
119	0.48
120	0.49
121	0.53
122	0.56
123	0.52
124	0.55
125	0.53
126	0.52
127	0.51
128	0.43
129	0.38
130	0.32
131	0.27
132	0.23
133	0.25
134	0.23
135	0.22
136	0.23
137	0.2
138	0.18
139	0.18
140	0.18
141	0.14
142	0.13
143	0.14
144	0.14
145	0.13
146	0.12
147	0.14
148	0.12
149	0.12
150	0.14
151	0.13
152	0.13
153	0.13
154	0.14
155	0.12
156	0.12
157	0.13
158	0.1
159	0.08
160	0.07
161	0.07
162	0.08
163	0.08
164	0.08
165	0.09
166	0.09
167	0.13
168	0.13
169	0.13
170	0.12
171	0.12
172	0.12
173	0.1
174	0.1
175	0.07
176	0.06
177	0.05
178	0.05
179	0.04
180	0.04
181	0.04
182	0.04
183	0.04
184	0.05
185	0.06
186	0.06
187	0.07
188	0.07
189	0.07
190	0.07
191	0.07
192	0.06
193	0.05
194	0.05
195	0.05
196	0.04
197	0.04
198	0.04
199	0.04
200	0.03
201	0.03
202	0.04
203	0.05
204	0.09
205	0.14
206	0.16
207	0.2
208	0.22
209	0.22
210	0.23
211	0.23
212	0.22
213	0.21
214	0.21
215	0.18
216	0.16
217	0.16
218	0.15
219	0.14
220	0.11
221	0.09
222	0.07
223	0.06
224	0.06
225	0.07
226	0.07
227	0.07
228	0.07
229	0.07
230	0.07
231	0.07
232	0.07
233	0.06
234	0.06
235	0.06
236	0.06
237	0.06
238	0.06
239	0.07
240	0.07
241	0.07
242	0.07
243	0.07
244	0.08
245	0.1
246	0.1
247	0.09
248	0.09
249	0.09
250	0.1
251	0.1
252	0.1
253	0.08
254	0.07
255	0.07
256	0.06
257	0.06
258	0.06
259	0.05
260	0.06
261	0.07
262	0.07
263	0.08
264	0.07
265	0.08
266	0.06
267	0.07
268	0.08
269	0.07
270	0.07
271	0.07
272	0.07
273	0.08
274	0.08
275	0.12
276	0.1
277	0.11
278	0.12
279	0.12
280	0.13
281	0.13
282	0.13
283	0.1
284	0.1
285	0.11
286	0.12
287	0.13
288	0.15
289	0.17
290	0.19
291	0.21
292	0.22
293	0.26
294	0.28
295	0.28
296	0.29
297	0.32
298	0.32
299	0.33
300	0.34
301	0.3
302	0.28
303	0.28
304	0.27
305	0.23
306	0.23
307	0.2
308	0.18
309	0.16
310	0.17
311	0.18
312	0.16
313	0.17
314	0.18
315	0.21
316	0.21
317	0.23
318	0.21
319	0.23
320	0.23
321	0.21
322	0.18
323	0.14
324	0.15
325	0.14
326	0.16
327	0.13
328	0.15
329	0.18
330	0.2
331	0.21
332	0.22
333	0.27
334	0.32
335	0.36
336	0.4
337	0.42
338	0.43
339	0.45
340	0.5
341	0.5
342	0.5
343	0.53
344	0.53
345	0.57
346	0.63
347	0.68
348	0.69
349	0.74
350	0.77
351	0.73
352	0.69
353	0.62
354	0.57
355	0.5
356	0.43
357	0.36
358	0.27
359	0.24
360	0.25
361	0.23
362	0.18
363	0.2
364	0.18
365	0.14
366	0.15
367	0.14
368	0.16
369	0.16
370	0.18
371	0.18
372	0.23
373	0.23
374	0.23
375	0.28
376	0.25
377	0.26
378	0.27
379	0.25
380	0.2
381	0.2
382	0.21
383	0.16
384	0.16
385	0.16
386	0.14
387	0.15
388	0.16
389	0.17
390	0.16
391	0.16
392	0.16
393	0.16
394	0.17
395	0.18
396	0.17
397	0.17
398	0.18
399	0.22
400	0.24
401	0.23
402	0.22
403	0.21
404	0.21
405	0.23
406	0.24
407	0.23
408	0.19
409	0.2
410	0.22
411	0.22
412	0.22
413	0.18
414	0.15
415	0.16
416	0.18
417	0.19
418	0.21
419	0.23
420	0.23
421	0.24
422	0.26
423	0.24
424	0.29
425	0.35
426	0.38
427	0.36
428	0.37
429	0.42
430	0.41
431	0.42
432	0.4
433	0.32
434	0.29
435	0.34
436	0.34
437	0.34
438	0.33
439	0.32
440	0.26
441	0.26
442	0.23
443	0.2
444	0.19
445	0.15
446	0.18
447	0.18
448	0.19
449	0.22
450	0.2
451	0.2
452	0.19
453	0.19
454	0.14
455	0.13
456	0.14
457	0.11
458	0.13
459	0.11
460	0.12
461	0.13
462	0.13
463	0.18
464	0.21
465	0.22
466	0.27
467	0.34
468	0.34
469	0.37
470	0.45
471	0.47
472	0.45
473	0.45
474	0.41
475	0.35
476	0.39
477	0.36
478	0.29
479	0.23
480	0.2
481	0.19
482	0.17
483	0.18
484	0.13
485	0.18
486	0.18
487	0.24
488	0.28
489	0.31
490	0.32
491	0.38
492	0.44
493	0.45
494	0.54
495	0.5
496	0.53
497	0.6
498	0.61
499	0.56
500	0.54
501	0.53
502	0.47
503	0.5
504	0.51
505	0.48
506	0.53
507	0.58
508	0.6
509	0.58
510	0.57
511	0.62
512	0.6
513	0.62
514	0.6
515	0.63
516	0.59
517	0.64
518	0.7
519	0.68
520	0.7
521	0.7
522	0.7
523	0.71
524	0.75
525	0.78
526	0.76
527	0.78
528	0.79
529	0.8
530	0.8
531	0.8
532	0.82
533	0.82
534	0.85
535	0.85
536	0.86
537	0.85
538	0.88
539	0.88
540	0.87
541	0.87
542	0.85
543	0.84
544	0.83
545	0.8
546	0.78
547	0.77
548	0.74
549	0.72
550	0.7
551	0.68
552	0.68
553	0.7
554	0.65

A0A0D2AUA5

3D AlphaFold-predicted Structure Viewer