Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9P7W9

Protein Details
Accession Q9P7W9   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
62-87RKESVASKKRKKLSSKEKKKLQLNVVHydrophilic
NLS Segment(s)
PositionSequence
64-81ESVASKKRKKLSSKEKKK
Subcellular Location(s) nucl 15.5, mito_nucl 11.666, cyto_nucl 11.333, mito 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016848  RNase_P/MRP_Rpp29-subunit  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
IPR002730  Rpp29/RNP1  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0005730  C:nucleolus  
GO:0000172  C:ribonuclease MRP complex  
GO:0030677  C:ribonuclease P complex  
GO:0004526  F:ribonuclease P activity  
GO:0033204  F:ribonuclease P RNA binding  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:1905267  P:endonucleolytic cleavage involved in tRNA processing  
GO:0006364  P:rRNA processing  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01868  RNase_P-MRP_p29  
Amino Acid Sequences MADPLYSSLKTVNSTSKVTPESLVFQTKILTPEEAKNVINEKIAFKPLLLVPSLNLEKQGDRKESVASKKRKKLSSKEKKKLQLNVVPKIADYSQFKHLHSMWCSYILEVIAGCTGESLMAKLAKAEYQGAYMQVLRSKSTTRVGLEGICIHESKHMLSLITKENRVVRVPKQDSVMKVIVDVPQRKLVFELYTQHLLLRAGDRSNKRFKSKNTIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.36
4 0.36
5 0.35
6 0.33
7 0.28
8 0.29
9 0.29
10 0.32
11 0.27
12 0.25
13 0.25
14 0.26
15 0.26
16 0.23
17 0.21
18 0.19
19 0.23
20 0.28
21 0.29
22 0.26
23 0.27
24 0.29
25 0.27
26 0.28
27 0.25
28 0.23
29 0.23
30 0.26
31 0.23
32 0.2
33 0.22
34 0.2
35 0.21
36 0.18
37 0.15
38 0.13
39 0.19
40 0.21
41 0.17
42 0.17
43 0.16
44 0.18
45 0.24
46 0.29
47 0.26
48 0.26
49 0.27
50 0.3
51 0.35
52 0.43
53 0.46
54 0.5
55 0.57
56 0.64
57 0.71
58 0.74
59 0.76
60 0.77
61 0.79
62 0.81
63 0.82
64 0.84
65 0.85
66 0.86
67 0.85
68 0.82
69 0.78
70 0.75
71 0.71
72 0.67
73 0.61
74 0.52
75 0.44
76 0.39
77 0.3
78 0.26
79 0.22
80 0.19
81 0.25
82 0.27
83 0.27
84 0.29
85 0.3
86 0.31
87 0.3
88 0.3
89 0.22
90 0.22
91 0.21
92 0.18
93 0.17
94 0.12
95 0.1
96 0.07
97 0.06
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.05
108 0.05
109 0.05
110 0.06
111 0.06
112 0.07
113 0.08
114 0.07
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.11
122 0.12
123 0.11
124 0.12
125 0.13
126 0.16
127 0.19
128 0.22
129 0.2
130 0.21
131 0.21
132 0.2
133 0.2
134 0.19
135 0.16
136 0.14
137 0.13
138 0.12
139 0.13
140 0.13
141 0.13
142 0.14
143 0.13
144 0.12
145 0.13
146 0.17
147 0.23
148 0.26
149 0.26
150 0.26
151 0.29
152 0.31
153 0.34
154 0.35
155 0.33
156 0.4
157 0.44
158 0.44
159 0.45
160 0.47
161 0.45
162 0.46
163 0.42
164 0.31
165 0.28
166 0.27
167 0.26
168 0.3
169 0.31
170 0.28
171 0.34
172 0.34
173 0.33
174 0.33
175 0.31
176 0.26
177 0.26
178 0.28
179 0.26
180 0.29
181 0.29
182 0.28
183 0.27
184 0.25
185 0.24
186 0.22
187 0.2
188 0.21
189 0.29
190 0.36
191 0.42
192 0.52
193 0.57
194 0.62
195 0.67
196 0.7
197 0.73