Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZY25

Protein Details
Accession A0A0D1ZY25   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-36QKAPRLPPLPRLKVKKPNKTLESHydrophilic
NLS Segment(s)
PositionSequence
99-102KKKK
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MVPKPPGSSAVSIQKAPRLPPLPRLKVKKPNKTLESPCMGIMSSVLGCWASSGQGAKACAVLEQQLRICMDQKATTKPQGNNINYHLQRFYSRVVGPEKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.39
5 0.36
6 0.35
7 0.42
8 0.52
9 0.55
10 0.61
11 0.68
12 0.68
13 0.73
14 0.81
15 0.82
16 0.8
17 0.81
18 0.78
19 0.79
20 0.75
21 0.71
22 0.66
23 0.56
24 0.47
25 0.38
26 0.32
27 0.23
28 0.17
29 0.11
30 0.07
31 0.05
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.05
40 0.05
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.1
49 0.1
50 0.11
51 0.12
52 0.13
53 0.14
54 0.14
55 0.16
56 0.14
57 0.15
58 0.18
59 0.21
60 0.26
61 0.29
62 0.36
63 0.41
64 0.42
65 0.49
66 0.54
67 0.53
68 0.52
69 0.52
70 0.55
71 0.49
72 0.5
73 0.42
74 0.34
75 0.34
76 0.32
77 0.31
78 0.27
79 0.27
80 0.29
81 0.37
82 0.44