Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P30261

Protein Details
Accession P30261    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
286-312IIKSVSGGKRRGKRKVKKYATTKDEEGBasic
345-366TVNIATKKKNTAQSKPQQKSIMHydrophilic
NLS Segment(s)
PositionSequence
200-217GNSSRKNKKAPLENHKEK
292-303GGKRRGKRKVKK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0043625  C:delta DNA polymerase complex  
GO:0005634  C:nucleus  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0051301  P:cell division  
GO:0006271  P:DNA strand elongation involved in DNA replication  
GO:1904161  P:DNA synthesis involved in UV-damage excision repair  
GO:1903459  P:mitotic DNA replication lagging strand elongation  
GO:1903460  P:mitotic DNA replication leading strand elongation  
GO:0006297  P:nucleotide-excision repair, DNA gap filling  
KEGG spo:SPBC1734.02c  -  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MEEWRNFLDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQGNDFLYPIYLIHGQPIDDEINLEIDEESQPISNFPVLQYILCDKSSLQEKQSRLKSGYKTVIFALSSAPLSDFDELLPAVYEIREKDVLYKKEDADKYGFIFNENSVPRVLKKAPSTHSPQLSVPSKTSTIDKTDTRSTEKTKGKDIFSNARNQKGNSSRKNKKAPLENHKEKEPLLPKEEKLSEQAKRERDDLKNIMQLEDESVSTTSVHDSEDDNLDSNNFQLEIGTEAKSAAPDEPQEIIKSVSGGKRRGKRKVKKYATTKDEEGFLVTKEEEVWESFSEDENISTGTSNVVRNKPTTVNIATKKKNTAQSKPQQKSIMSFFGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.21
4 0.19
5 0.16
6 0.1
7 0.1
8 0.1
9 0.11
10 0.1
11 0.1
12 0.09
13 0.08
14 0.07
15 0.08
16 0.08
17 0.1
18 0.11
19 0.11
20 0.11
21 0.12
22 0.12
23 0.16
24 0.18
25 0.19
26 0.21
27 0.24
28 0.23
29 0.23
30 0.24
31 0.22
32 0.2
33 0.16
34 0.14
35 0.1
36 0.11
37 0.11
38 0.09
39 0.11
40 0.12
41 0.12
42 0.15
43 0.16
44 0.15
45 0.15
46 0.17
47 0.15
48 0.12
49 0.13
50 0.1
51 0.11
52 0.1
53 0.11
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.08
62 0.1
63 0.1
64 0.1
65 0.1
66 0.14
67 0.13
68 0.13
69 0.15
70 0.17
71 0.19
72 0.18
73 0.19
74 0.14
75 0.18
76 0.26
77 0.26
78 0.28
79 0.32
80 0.35
81 0.44
82 0.5
83 0.5
84 0.47
85 0.51
86 0.5
87 0.52
88 0.57
89 0.49
90 0.44
91 0.4
92 0.39
93 0.32
94 0.28
95 0.21
96 0.14
97 0.13
98 0.11
99 0.11
100 0.08
101 0.1
102 0.1
103 0.09
104 0.08
105 0.09
106 0.08
107 0.08
108 0.07
109 0.06
110 0.05
111 0.05
112 0.07
113 0.06
114 0.1
115 0.11
116 0.11
117 0.18
118 0.26
119 0.29
120 0.32
121 0.35
122 0.34
123 0.41
124 0.42
125 0.37
126 0.32
127 0.3
128 0.28
129 0.28
130 0.26
131 0.19
132 0.19
133 0.16
134 0.2
135 0.18
136 0.18
137 0.15
138 0.16
139 0.15
140 0.19
141 0.21
142 0.19
143 0.23
144 0.28
145 0.31
146 0.35
147 0.42
148 0.43
149 0.44
150 0.41
151 0.38
152 0.38
153 0.39
154 0.35
155 0.29
156 0.25
157 0.24
158 0.22
159 0.24
160 0.18
161 0.18
162 0.2
163 0.2
164 0.22
165 0.26
166 0.27
167 0.3
168 0.31
169 0.31
170 0.37
171 0.41
172 0.39
173 0.43
174 0.45
175 0.42
176 0.43
177 0.43
178 0.42
179 0.39
180 0.47
181 0.42
182 0.44
183 0.43
184 0.4
185 0.42
186 0.43
187 0.5
188 0.5
189 0.58
190 0.6
191 0.67
192 0.76
193 0.74
194 0.72
195 0.72
196 0.72
197 0.73
198 0.75
199 0.76
200 0.7
201 0.67
202 0.62
203 0.53
204 0.51
205 0.48
206 0.41
207 0.37
208 0.38
209 0.35
210 0.4
211 0.41
212 0.34
213 0.32
214 0.33
215 0.32
216 0.36
217 0.42
218 0.41
219 0.42
220 0.44
221 0.46
222 0.44
223 0.47
224 0.44
225 0.42
226 0.41
227 0.39
228 0.36
229 0.29
230 0.26
231 0.2
232 0.17
233 0.12
234 0.09
235 0.09
236 0.09
237 0.09
238 0.09
239 0.08
240 0.07
241 0.08
242 0.08
243 0.08
244 0.1
245 0.13
246 0.13
247 0.12
248 0.12
249 0.12
250 0.11
251 0.1
252 0.09
253 0.07
254 0.06
255 0.05
256 0.06
257 0.08
258 0.1
259 0.1
260 0.1
261 0.1
262 0.1
263 0.11
264 0.11
265 0.09
266 0.09
267 0.09
268 0.11
269 0.13
270 0.14
271 0.15
272 0.15
273 0.15
274 0.13
275 0.14
276 0.16
277 0.19
278 0.24
279 0.3
280 0.38
281 0.45
282 0.53
283 0.63
284 0.7
285 0.76
286 0.81
287 0.85
288 0.87
289 0.89
290 0.91
291 0.91
292 0.88
293 0.84
294 0.77
295 0.68
296 0.59
297 0.5
298 0.42
299 0.32
300 0.25
301 0.2
302 0.16
303 0.14
304 0.12
305 0.13
306 0.12
307 0.12
308 0.14
309 0.12
310 0.14
311 0.14
312 0.15
313 0.16
314 0.15
315 0.14
316 0.12
317 0.12
318 0.11
319 0.11
320 0.1
321 0.1
322 0.13
323 0.17
324 0.24
325 0.28
326 0.31
327 0.32
328 0.37
329 0.38
330 0.39
331 0.41
332 0.39
333 0.44
334 0.5
335 0.58
336 0.61
337 0.63
338 0.67
339 0.67
340 0.72
341 0.71
342 0.72
343 0.73
344 0.76
345 0.82
346 0.8
347 0.81
348 0.78
349 0.71
350 0.67
351 0.63
352 0.62