Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1ZZK4

Protein Details
Accession A0A0D1ZZK4   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
295-316KTFFMWRIRKMMKKRGVREYKKBasic
NLS Segment(s)
PositionSequence
303-316RKMMKKRGVREYKK
Subcellular Location(s) cyto 13, cyto_nucl 11, nucl 7, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018713  MPAB/Lcp_cat_dom  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF09995  MPAB_Lcp_cat  
Amino Acid Sequences MAAAVDYGHAERWSQSEKSEDVIEAEKTRLKHSEDPQYEPVAEIHEIKKIIREGITLTSGLTAVLLQVAHPVVGRGVGIHSEFSKPGRAVDRAEKTGIFIYVFVFGTEEQKKAMQHYINMMHSRVKGGEGKTAYYAKDPHAQLWVAATLYATMIGMYEMAFGPLPHNRAERVYKEFSYLGTALQMPPELWPVNRAAFWRYYADMIENHLEVTPEAEKVLYDLLHPFKPAPWYAKPFVPFLMPIVKAITIEQLPVKVRQDYGLRSTKFTRFVNSFTVATATSVYPALPLFIRQAPKTFFMWRIRKMMKKRGVREYKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.25
5 0.27
6 0.28
7 0.24
8 0.22
9 0.24
10 0.24
11 0.21
12 0.23
13 0.24
14 0.23
15 0.26
16 0.29
17 0.32
18 0.37
19 0.43
20 0.52
21 0.52
22 0.58
23 0.58
24 0.56
25 0.51
26 0.43
27 0.36
28 0.28
29 0.25
30 0.22
31 0.19
32 0.2
33 0.2
34 0.19
35 0.24
36 0.23
37 0.24
38 0.21
39 0.21
40 0.2
41 0.23
42 0.24
43 0.19
44 0.17
45 0.15
46 0.14
47 0.12
48 0.1
49 0.06
50 0.04
51 0.05
52 0.05
53 0.04
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.07
65 0.07
66 0.08
67 0.09
68 0.11
69 0.12
70 0.13
71 0.17
72 0.16
73 0.19
74 0.22
75 0.23
76 0.26
77 0.34
78 0.39
79 0.36
80 0.38
81 0.34
82 0.31
83 0.3
84 0.27
85 0.18
86 0.12
87 0.1
88 0.11
89 0.11
90 0.09
91 0.09
92 0.08
93 0.14
94 0.15
95 0.15
96 0.13
97 0.15
98 0.16
99 0.18
100 0.23
101 0.19
102 0.19
103 0.24
104 0.28
105 0.3
106 0.31
107 0.29
108 0.27
109 0.26
110 0.25
111 0.2
112 0.18
113 0.18
114 0.17
115 0.22
116 0.19
117 0.2
118 0.21
119 0.22
120 0.21
121 0.19
122 0.19
123 0.16
124 0.23
125 0.22
126 0.21
127 0.22
128 0.21
129 0.19
130 0.18
131 0.16
132 0.09
133 0.08
134 0.07
135 0.05
136 0.05
137 0.05
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.04
148 0.04
149 0.05
150 0.07
151 0.09
152 0.1
153 0.11
154 0.11
155 0.15
156 0.18
157 0.21
158 0.25
159 0.27
160 0.26
161 0.28
162 0.27
163 0.24
164 0.24
165 0.2
166 0.14
167 0.12
168 0.12
169 0.09
170 0.1
171 0.1
172 0.06
173 0.07
174 0.09
175 0.09
176 0.08
177 0.1
178 0.11
179 0.12
180 0.13
181 0.14
182 0.14
183 0.14
184 0.16
185 0.17
186 0.16
187 0.15
188 0.15
189 0.15
190 0.14
191 0.15
192 0.15
193 0.13
194 0.12
195 0.11
196 0.11
197 0.09
198 0.11
199 0.09
200 0.08
201 0.08
202 0.07
203 0.07
204 0.07
205 0.08
206 0.06
207 0.06
208 0.1
209 0.13
210 0.14
211 0.15
212 0.15
213 0.16
214 0.19
215 0.22
216 0.24
217 0.27
218 0.32
219 0.35
220 0.39
221 0.39
222 0.37
223 0.35
224 0.3
225 0.24
226 0.2
227 0.23
228 0.19
229 0.18
230 0.18
231 0.17
232 0.16
233 0.16
234 0.17
235 0.11
236 0.12
237 0.13
238 0.15
239 0.16
240 0.2
241 0.22
242 0.21
243 0.21
244 0.24
245 0.28
246 0.28
247 0.34
248 0.4
249 0.38
250 0.4
251 0.45
252 0.46
253 0.48
254 0.45
255 0.45
256 0.39
257 0.41
258 0.42
259 0.41
260 0.36
261 0.3
262 0.3
263 0.23
264 0.21
265 0.19
266 0.14
267 0.11
268 0.11
269 0.1
270 0.1
271 0.09
272 0.1
273 0.09
274 0.1
275 0.13
276 0.18
277 0.24
278 0.24
279 0.3
280 0.32
281 0.35
282 0.37
283 0.38
284 0.41
285 0.46
286 0.53
287 0.53
288 0.6
289 0.65
290 0.71
291 0.75
292 0.78
293 0.78
294 0.79
295 0.82
296 0.83