Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A898

Protein Details
Accession A0A0D2A898   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
70-101AAEDSDRARKRRRRRRRRRGKKKSITTTLDDDBasic
NLS Segment(s)
PositionSequence
52-92SRKRPTRTVEKGRWGKGMAAEDSDRARKRRRRRRRRRGKKK
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MGQTLKIPHAVRSLDVPVTRIPPIAGFAGFKKLFFFLPFSVPPSPHHPSHLSRKRPTRTVEKGRWGKGMAAEDSDRARKRRRRRRRRRGKKKSITTTLDDDGRRPRLLPRRDAAYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.23
5 0.25
6 0.24
7 0.21
8 0.18
9 0.14
10 0.16
11 0.15
12 0.13
13 0.12
14 0.12
15 0.2
16 0.2
17 0.19
18 0.18
19 0.18
20 0.18
21 0.18
22 0.2
23 0.13
24 0.17
25 0.18
26 0.21
27 0.22
28 0.22
29 0.23
30 0.27
31 0.3
32 0.26
33 0.29
34 0.29
35 0.32
36 0.43
37 0.49
38 0.5
39 0.53
40 0.62
41 0.63
42 0.64
43 0.64
44 0.63
45 0.63
46 0.65
47 0.64
48 0.65
49 0.67
50 0.63
51 0.61
52 0.52
53 0.44
54 0.37
55 0.33
56 0.24
57 0.2
58 0.18
59 0.17
60 0.18
61 0.23
62 0.24
63 0.25
64 0.34
65 0.4
66 0.51
67 0.61
68 0.7
69 0.76
70 0.84
71 0.92
72 0.94
73 0.97
74 0.97
75 0.98
76 0.98
77 0.97
78 0.97
79 0.96
80 0.94
81 0.88
82 0.81
83 0.75
84 0.68
85 0.63
86 0.52
87 0.45
88 0.43
89 0.42
90 0.38
91 0.33
92 0.38
93 0.42
94 0.49
95 0.54
96 0.52