Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YH21

Protein Details
Accession A0A0D1YH21   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
85-104ICRQCGRRCRKSPAQNGDRKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10cyto_nucl 10, cyto 9, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000814  TBP  
IPR012295  TBP_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF00352  TBP  
CDD cd00652  TBP_TLF  
Amino Acid Sequences MSCHIDLTLFAQHARNCEYIPKRFAAAGVRIREPKTTRLIVSNGNCVVMGAKSVDDSRLAARKHVRIVKKVGYTPRFDGFQVCNICRQCGRRCRKSPAQNGDRKHGIVRQKDFVPLDGFTLRYIRFASYYPETFAGCVYKMMRPNLRLLIFPNGKIVFTGAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.23
4 0.31
5 0.36
6 0.39
7 0.41
8 0.4
9 0.37
10 0.36
11 0.38
12 0.34
13 0.35
14 0.35
15 0.35
16 0.39
17 0.41
18 0.42
19 0.46
20 0.43
21 0.4
22 0.4
23 0.39
24 0.36
25 0.36
26 0.37
27 0.38
28 0.38
29 0.39
30 0.32
31 0.29
32 0.27
33 0.23
34 0.21
35 0.13
36 0.12
37 0.06
38 0.06
39 0.06
40 0.07
41 0.08
42 0.07
43 0.08
44 0.11
45 0.16
46 0.16
47 0.2
48 0.24
49 0.27
50 0.33
51 0.39
52 0.4
53 0.39
54 0.45
55 0.46
56 0.46
57 0.47
58 0.48
59 0.45
60 0.44
61 0.42
62 0.39
63 0.33
64 0.29
65 0.28
66 0.21
67 0.24
68 0.24
69 0.21
70 0.24
71 0.23
72 0.24
73 0.24
74 0.28
75 0.29
76 0.36
77 0.45
78 0.5
79 0.56
80 0.64
81 0.72
82 0.77
83 0.79
84 0.8
85 0.81
86 0.77
87 0.74
88 0.71
89 0.64
90 0.55
91 0.47
92 0.41
93 0.39
94 0.4
95 0.41
96 0.39
97 0.38
98 0.42
99 0.4
100 0.37
101 0.32
102 0.24
103 0.23
104 0.19
105 0.19
106 0.15
107 0.17
108 0.15
109 0.14
110 0.15
111 0.13
112 0.13
113 0.14
114 0.19
115 0.21
116 0.23
117 0.23
118 0.24
119 0.23
120 0.22
121 0.22
122 0.19
123 0.14
124 0.15
125 0.15
126 0.18
127 0.23
128 0.3
129 0.35
130 0.35
131 0.4
132 0.45
133 0.44
134 0.41
135 0.39
136 0.43
137 0.39
138 0.38
139 0.4
140 0.33
141 0.32
142 0.3