Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2A099

Protein Details
Accession A0A0D2A099    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-49KKHIPIVKKRTARFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
34-55RKPKGIDNRVRRRFKGQAPMPK
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHIPIVKKRTARFNRHQSDRFKCVDPSWRKPKGIDNRVRRRFKGQAPMPKIGYGSNKKTKHLTPSGHKIFLVNNASDVDLLLMHNQTYAAEIAHAVSARKRIEIIAKAKSLGVKVTNAKAKVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.79
4 0.79
5 0.81
6 0.81
7 0.82
8 0.85
9 0.83
10 0.81
11 0.77
12 0.71
13 0.63
14 0.55
15 0.49
16 0.52
17 0.52
18 0.54
19 0.58
20 0.61
21 0.59
22 0.59
23 0.65
24 0.65
25 0.67
26 0.67
27 0.68
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.58
41 0.51
42 0.45
43 0.37
44 0.37
45 0.32
46 0.34
47 0.39
48 0.4
49 0.41
50 0.44
51 0.44
52 0.43
53 0.45
54 0.43
55 0.4
56 0.49
57 0.51
58 0.48
59 0.46
60 0.39
61 0.33
62 0.34
63 0.3
64 0.2
65 0.17
66 0.16
67 0.16
68 0.16
69 0.14
70 0.08
71 0.05
72 0.06
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.07
88 0.09
89 0.14
90 0.15
91 0.16
92 0.16
93 0.17
94 0.23
95 0.3
96 0.34
97 0.35
98 0.36
99 0.36
100 0.37
101 0.37
102 0.31
103 0.28
104 0.24
105 0.24
106 0.27
107 0.34
108 0.4
109 0.39
110 0.4
111 0.39