Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YV56

Protein Details
Accession A0A0D1YV56    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-44AMKQHRQQIKHRSPTTKRSQQPRLRDHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDGTRARSVSQVSVVDRAMKQHRQQIKHRSPTTKRSQQPRLRDHLVGASGKKSDARSSHPRAAAGLGCARSASVSPTVLRGSLTKRNDEQKPHPWLCIGHADKKDPDTQTFCTACTRRTGRPVTSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.26
4 0.29
5 0.32
6 0.36
7 0.38
8 0.44
9 0.52
10 0.55
11 0.63
12 0.69
13 0.72
14 0.75
15 0.78
16 0.79
17 0.77
18 0.8
19 0.82
20 0.8
21 0.77
22 0.76
23 0.8
24 0.78
25 0.81
26 0.79
27 0.77
28 0.71
29 0.65
30 0.56
31 0.48
32 0.43
33 0.35
34 0.28
35 0.22
36 0.17
37 0.17
38 0.18
39 0.16
40 0.16
41 0.16
42 0.23
43 0.3
44 0.37
45 0.42
46 0.41
47 0.4
48 0.37
49 0.36
50 0.29
51 0.22
52 0.17
53 0.12
54 0.1
55 0.1
56 0.1
57 0.08
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.1
64 0.11
65 0.11
66 0.11
67 0.11
68 0.15
69 0.22
70 0.24
71 0.27
72 0.31
73 0.38
74 0.43
75 0.48
76 0.51
77 0.52
78 0.59
79 0.57
80 0.53
81 0.48
82 0.43
83 0.39
84 0.42
85 0.37
86 0.35
87 0.37
88 0.4
89 0.4
90 0.42
91 0.45
92 0.38
93 0.39
94 0.36
95 0.37
96 0.41
97 0.39
98 0.37
99 0.4
100 0.39
101 0.36
102 0.4
103 0.42
104 0.4
105 0.49
106 0.54
107 0.51