Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1XTE1

Protein Details
Accession A0A0D1XTE1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
248-272GEVIEGYKPKHKKKTKDEPSLELGDBasic
NLS Segment(s)
PositionSequence
257-261KHKKK
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039693  Rtr1/RPAP2  
IPR007308  Rtr1/RPAP2_dom  
IPR038534  Rtr1/RPAP2_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0017018  F:myosin phosphatase activity  
GO:0043175  F:RNA polymerase core enzyme binding  
GO:0008420  F:RNA polymerase II CTD heptapeptide repeat phosphatase activity  
Pfam View protein in Pfam  
PF04181  RPAP2_Rtr1  
PROSITE View protein in PROSITE  
PS51479  ZF_RTR1  
Amino Acid Sequences MAPKSILKKTPASSSAAQQQRPTTKSRDERNREIALYHANLIQAQKDVEAAIVSAIETLIDFPAHPSSTSASPDASDVAEFTRLVYIFTPGDYDELIEERRIDGRCGYVFCRNAPKTTQGGGRLKILGGGRVVDRGRAESWCSAVCAKRAMWIKVQLIETPAWERRGAVEGGQIDIMTGDADQAGSAGAQLRGDEDDLERKMKELALERGDGEKPARSAGMVSNVLVEKDTVKPPSAPEPDGSEQTEGEVIEGYKPKHKKKTKDEPSLELGDQDWVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.52
4 0.51
5 0.46
6 0.52
7 0.54
8 0.54
9 0.53
10 0.5
11 0.53
12 0.59
13 0.65
14 0.69
15 0.69
16 0.75
17 0.78
18 0.77
19 0.67
20 0.59
21 0.52
22 0.46
23 0.39
24 0.32
25 0.25
26 0.21
27 0.22
28 0.22
29 0.2
30 0.15
31 0.13
32 0.12
33 0.11
34 0.1
35 0.09
36 0.08
37 0.07
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.03
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.09
51 0.1
52 0.1
53 0.11
54 0.13
55 0.16
56 0.18
57 0.17
58 0.15
59 0.15
60 0.15
61 0.15
62 0.12
63 0.1
64 0.08
65 0.08
66 0.09
67 0.08
68 0.08
69 0.1
70 0.09
71 0.1
72 0.1
73 0.11
74 0.1
75 0.1
76 0.11
77 0.08
78 0.09
79 0.08
80 0.08
81 0.06
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.12
88 0.13
89 0.13
90 0.13
91 0.15
92 0.16
93 0.17
94 0.19
95 0.21
96 0.22
97 0.23
98 0.32
99 0.3
100 0.31
101 0.31
102 0.33
103 0.29
104 0.31
105 0.32
106 0.3
107 0.32
108 0.32
109 0.31
110 0.27
111 0.25
112 0.25
113 0.22
114 0.15
115 0.12
116 0.11
117 0.1
118 0.13
119 0.13
120 0.11
121 0.11
122 0.12
123 0.12
124 0.12
125 0.14
126 0.11
127 0.12
128 0.11
129 0.12
130 0.12
131 0.12
132 0.13
133 0.13
134 0.12
135 0.17
136 0.21
137 0.22
138 0.23
139 0.27
140 0.27
141 0.29
142 0.3
143 0.25
144 0.23
145 0.21
146 0.19
147 0.18
148 0.19
149 0.16
150 0.15
151 0.15
152 0.14
153 0.17
154 0.16
155 0.12
156 0.13
157 0.12
158 0.13
159 0.13
160 0.11
161 0.08
162 0.08
163 0.07
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.07
180 0.07
181 0.08
182 0.08
183 0.13
184 0.14
185 0.16
186 0.15
187 0.15
188 0.16
189 0.16
190 0.18
191 0.19
192 0.24
193 0.25
194 0.26
195 0.26
196 0.29
197 0.28
198 0.26
199 0.22
200 0.19
201 0.16
202 0.16
203 0.16
204 0.12
205 0.13
206 0.14
207 0.2
208 0.17
209 0.17
210 0.19
211 0.19
212 0.19
213 0.18
214 0.16
215 0.11
216 0.14
217 0.18
218 0.17
219 0.19
220 0.2
221 0.23
222 0.32
223 0.35
224 0.33
225 0.31
226 0.36
227 0.38
228 0.4
229 0.39
230 0.31
231 0.26
232 0.26
233 0.25
234 0.17
235 0.14
236 0.12
237 0.1
238 0.13
239 0.18
240 0.19
241 0.26
242 0.34
243 0.43
244 0.53
245 0.62
246 0.68
247 0.75
248 0.84
249 0.87
250 0.9
251 0.88
252 0.83
253 0.81
254 0.76
255 0.65
256 0.54
257 0.44