Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2AXJ6

Protein Details
Accession A0A0D2AXJ6    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-52LIEPQFSGAKKRKRNNDSEARKEKKRRRNKKPNDIHEDDLDBasic
NLS Segment(s)
PositionSequence
20-43AKKRKRNNDSEARKEKKRRRNKKP
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MSDSDNEGGVPLIEPQFSGAKKRKRNNDSEARKEKKRRRNKKPNDIHEDDLDEELGVNLAIGRMDGDLMVNYVARRTKKFEPDLSPVELDELYLPAKSVRDTSSWDKPRTLDNLPSFVREFADKDENLELAKQDPGCPHTIVVAAAGIRAADLTRALRVFQSKKESGGKVTKLFAKHIKLKEAIEECRKTRISLGVGTPQRIHDLLEDGALSAKHLKRIIIDASYIDQKKRGILDMKETEIPLVKLLTRKDLRERYEDATSPVKLLFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.17
4 0.18
5 0.26
6 0.33
7 0.41
8 0.51
9 0.61
10 0.69
11 0.74
12 0.82
13 0.83
14 0.85
15 0.86
16 0.87
17 0.88
18 0.85
19 0.85
20 0.87
21 0.87
22 0.86
23 0.87
24 0.88
25 0.88
26 0.93
27 0.94
28 0.95
29 0.96
30 0.95
31 0.94
32 0.89
33 0.81
34 0.72
35 0.64
36 0.54
37 0.44
38 0.33
39 0.23
40 0.16
41 0.12
42 0.09
43 0.06
44 0.04
45 0.03
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.08
60 0.13
61 0.15
62 0.18
63 0.23
64 0.3
65 0.39
66 0.45
67 0.49
68 0.52
69 0.56
70 0.57
71 0.54
72 0.47
73 0.38
74 0.33
75 0.26
76 0.19
77 0.13
78 0.1
79 0.07
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.09
86 0.1
87 0.11
88 0.16
89 0.22
90 0.31
91 0.38
92 0.39
93 0.39
94 0.38
95 0.4
96 0.4
97 0.37
98 0.35
99 0.3
100 0.34
101 0.32
102 0.33
103 0.3
104 0.26
105 0.23
106 0.17
107 0.16
108 0.13
109 0.17
110 0.15
111 0.16
112 0.17
113 0.16
114 0.15
115 0.15
116 0.11
117 0.08
118 0.1
119 0.08
120 0.09
121 0.1
122 0.12
123 0.13
124 0.13
125 0.12
126 0.11
127 0.12
128 0.1
129 0.09
130 0.08
131 0.06
132 0.05
133 0.05
134 0.04
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.06
142 0.06
143 0.07
144 0.08
145 0.14
146 0.16
147 0.2
148 0.27
149 0.27
150 0.31
151 0.36
152 0.36
153 0.36
154 0.4
155 0.39
156 0.34
157 0.36
158 0.36
159 0.32
160 0.35
161 0.36
162 0.35
163 0.4
164 0.4
165 0.43
166 0.42
167 0.41
168 0.43
169 0.42
170 0.42
171 0.42
172 0.43
173 0.4
174 0.44
175 0.44
176 0.37
177 0.35
178 0.34
179 0.29
180 0.28
181 0.3
182 0.32
183 0.33
184 0.34
185 0.33
186 0.28
187 0.28
188 0.24
189 0.22
190 0.15
191 0.16
192 0.14
193 0.14
194 0.13
195 0.1
196 0.12
197 0.1
198 0.1
199 0.14
200 0.15
201 0.19
202 0.2
203 0.21
204 0.21
205 0.26
206 0.28
207 0.23
208 0.23
209 0.2
210 0.22
211 0.29
212 0.29
213 0.26
214 0.26
215 0.25
216 0.27
217 0.28
218 0.31
219 0.3
220 0.31
221 0.4
222 0.42
223 0.45
224 0.44
225 0.42
226 0.37
227 0.33
228 0.31
229 0.22
230 0.19
231 0.17
232 0.2
233 0.22
234 0.3
235 0.32
236 0.37
237 0.46
238 0.53
239 0.55
240 0.57
241 0.6
242 0.55
243 0.58
244 0.54
245 0.48
246 0.46
247 0.41
248 0.36