Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1YN20

Protein Details
Accession A0A0D1YN20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-127LAAKVEKASRQQRKQRKNRQKELRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRQKELRGTAKVKGAKKKKGE
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDAPVTLRTRKFIRNPLLMRKQMVVDVLHPSRPNVSKDELRDKLASLYKANKDAVSVFGFRTQYGGGKSTGFALIYDSPEALKKFEPHYRQVRYGLAAKVEKASRQQRKQRKNRQKELRGTAKVKGAKKKKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.67
4 0.72
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.21
14 0.25
15 0.24
16 0.25
17 0.24
18 0.23
19 0.26
20 0.29
21 0.3
22 0.26
23 0.3
24 0.32
25 0.37
26 0.46
27 0.43
28 0.43
29 0.41
30 0.38
31 0.37
32 0.36
33 0.32
34 0.26
35 0.3
36 0.29
37 0.31
38 0.32
39 0.26
40 0.23
41 0.22
42 0.21
43 0.17
44 0.15
45 0.12
46 0.15
47 0.15
48 0.14
49 0.15
50 0.12
51 0.12
52 0.12
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.11
68 0.11
69 0.1
70 0.11
71 0.13
72 0.17
73 0.24
74 0.28
75 0.33
76 0.42
77 0.46
78 0.48
79 0.48
80 0.46
81 0.42
82 0.43
83 0.37
84 0.33
85 0.29
86 0.26
87 0.28
88 0.27
89 0.26
90 0.29
91 0.38
92 0.43
93 0.52
94 0.62
95 0.68
96 0.78
97 0.87
98 0.91
99 0.92
100 0.93
101 0.94
102 0.95
103 0.94
104 0.93
105 0.92
106 0.91
107 0.89
108 0.81
109 0.75
110 0.72
111 0.69
112 0.66
113 0.67
114 0.66