Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2ACZ6

Protein Details
Accession A0A0D2ACZ6    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-79EEAEKKARRERREQRRLERERARLEBasic
NLS Segment(s)
PositionSequence
59-76KKARRERREQRRLERERA
Subcellular Location(s) extr 11, plas 7, mito 4, pero 2, nucl 1, cyto 1, cyto_nucl 1, E.R. 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGWVYDTLGVPWACSLLGFLSLLMAVIPFVFVWKGNSIRGRSQFCQYLLQREIEEAEKKARRERREQRRLERERARLEASAGASGSLKDDSIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.05
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.04
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.04
19 0.04
20 0.06
21 0.09
22 0.11
23 0.14
24 0.19
25 0.21
26 0.26
27 0.32
28 0.36
29 0.35
30 0.37
31 0.37
32 0.34
33 0.38
34 0.33
35 0.34
36 0.3
37 0.29
38 0.26
39 0.22
40 0.22
41 0.18
42 0.19
43 0.14
44 0.2
45 0.23
46 0.25
47 0.32
48 0.38
49 0.41
50 0.5
51 0.6
52 0.64
53 0.7
54 0.79
55 0.82
56 0.86
57 0.88
58 0.87
59 0.85
60 0.82
61 0.78
62 0.73
63 0.65
64 0.55
65 0.49
66 0.43
67 0.35
68 0.29
69 0.22
70 0.18
71 0.15
72 0.14
73 0.14
74 0.11