Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2ANX3

Protein Details
Accession A0A0D2ANX3   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
275-300DVTTESRDKKHSKKKIPSLKKLVSAQHydrophilic
NLS Segment(s)
PositionSequence
283-292KKHSKKKIPS
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 8, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTSEYFNIKRKEVPNSAALMEEPKSPILTDEDERFLELITSDEQPPPLPERPAVIFDTAEKAKPKDAQIALMDGANKIPLPQSPPLDAEAEPSKSEEVKHKESKTHKKTESYLSYVRTLPQRFGGKKGKSKEQAGSDLQAAVEAAKKGEIVTTDPAASNEIEKTKEEQDLTSVLDQLNLSAVNNRAFSFSEKSQKMMAEFTQILKDIVNGVPTAYDDLEKFLKNWDEYLRKMYDDLPDFLKNLIKSLPSKMSASIAPGLLAAASEKPGADAKAMDVTTESRDKKHSKKKIPSLKKLVSAQGAVTGMLKSILNFLKLRFPAVVTGTNVLMSLAVFLLLFVFWYCHKRGKETRLEKERLAAQDAASDSDFEQTSSELEDSTLLENEAKVQRILNQPPPTSVSPAST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.49
4 0.42
5 0.37
6 0.31
7 0.25
8 0.24
9 0.2
10 0.18
11 0.18
12 0.17
13 0.18
14 0.18
15 0.22
16 0.23
17 0.25
18 0.28
19 0.28
20 0.28
21 0.27
22 0.23
23 0.19
24 0.14
25 0.12
26 0.11
27 0.14
28 0.15
29 0.16
30 0.17
31 0.17
32 0.2
33 0.24
34 0.26
35 0.26
36 0.25
37 0.28
38 0.3
39 0.33
40 0.32
41 0.27
42 0.23
43 0.22
44 0.28
45 0.25
46 0.26
47 0.25
48 0.25
49 0.28
50 0.32
51 0.34
52 0.36
53 0.36
54 0.37
55 0.36
56 0.37
57 0.33
58 0.29
59 0.27
60 0.18
61 0.17
62 0.13
63 0.11
64 0.09
65 0.09
66 0.1
67 0.14
68 0.19
69 0.22
70 0.24
71 0.26
72 0.27
73 0.28
74 0.26
75 0.25
76 0.24
77 0.23
78 0.21
79 0.2
80 0.2
81 0.18
82 0.2
83 0.25
84 0.28
85 0.35
86 0.43
87 0.45
88 0.52
89 0.61
90 0.71
91 0.71
92 0.74
93 0.71
94 0.69
95 0.71
96 0.72
97 0.69
98 0.64
99 0.59
100 0.52
101 0.49
102 0.44
103 0.42
104 0.4
105 0.34
106 0.29
107 0.32
108 0.37
109 0.36
110 0.43
111 0.5
112 0.5
113 0.56
114 0.6
115 0.63
116 0.6
117 0.64
118 0.61
119 0.57
120 0.55
121 0.5
122 0.46
123 0.37
124 0.31
125 0.26
126 0.2
127 0.15
128 0.09
129 0.09
130 0.08
131 0.07
132 0.06
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.1
139 0.11
140 0.12
141 0.12
142 0.12
143 0.13
144 0.12
145 0.11
146 0.1
147 0.11
148 0.11
149 0.12
150 0.15
151 0.16
152 0.19
153 0.18
154 0.17
155 0.16
156 0.16
157 0.17
158 0.15
159 0.13
160 0.1
161 0.11
162 0.11
163 0.09
164 0.09
165 0.07
166 0.06
167 0.07
168 0.09
169 0.1
170 0.11
171 0.11
172 0.11
173 0.12
174 0.15
175 0.17
176 0.19
177 0.26
178 0.25
179 0.26
180 0.27
181 0.27
182 0.25
183 0.23
184 0.2
185 0.15
186 0.15
187 0.15
188 0.14
189 0.13
190 0.13
191 0.11
192 0.11
193 0.08
194 0.08
195 0.08
196 0.07
197 0.06
198 0.06
199 0.06
200 0.07
201 0.06
202 0.06
203 0.05
204 0.08
205 0.1
206 0.1
207 0.1
208 0.12
209 0.14
210 0.14
211 0.16
212 0.2
213 0.21
214 0.23
215 0.27
216 0.26
217 0.23
218 0.24
219 0.24
220 0.24
221 0.22
222 0.23
223 0.22
224 0.21
225 0.22
226 0.22
227 0.23
228 0.17
229 0.16
230 0.15
231 0.14
232 0.15
233 0.18
234 0.22
235 0.2
236 0.21
237 0.21
238 0.22
239 0.19
240 0.2
241 0.18
242 0.14
243 0.12
244 0.11
245 0.1
246 0.08
247 0.07
248 0.05
249 0.04
250 0.05
251 0.05
252 0.05
253 0.06
254 0.07
255 0.08
256 0.08
257 0.08
258 0.08
259 0.13
260 0.13
261 0.12
262 0.11
263 0.12
264 0.15
265 0.22
266 0.22
267 0.19
268 0.26
269 0.33
270 0.43
271 0.52
272 0.59
273 0.63
274 0.73
275 0.81
276 0.86
277 0.9
278 0.9
279 0.9
280 0.85
281 0.82
282 0.75
283 0.69
284 0.6
285 0.5
286 0.4
287 0.33
288 0.28
289 0.21
290 0.17
291 0.13
292 0.1
293 0.1
294 0.1
295 0.07
296 0.12
297 0.13
298 0.15
299 0.16
300 0.17
301 0.24
302 0.25
303 0.26
304 0.22
305 0.21
306 0.22
307 0.24
308 0.27
309 0.2
310 0.21
311 0.2
312 0.19
313 0.18
314 0.14
315 0.11
316 0.07
317 0.06
318 0.04
319 0.04
320 0.04
321 0.04
322 0.04
323 0.04
324 0.04
325 0.04
326 0.05
327 0.07
328 0.12
329 0.15
330 0.22
331 0.24
332 0.33
333 0.42
334 0.51
335 0.6
336 0.66
337 0.74
338 0.76
339 0.8
340 0.72
341 0.69
342 0.65
343 0.58
344 0.52
345 0.42
346 0.32
347 0.32
348 0.32
349 0.29
350 0.22
351 0.2
352 0.16
353 0.18
354 0.18
355 0.13
356 0.13
357 0.11
358 0.12
359 0.13
360 0.13
361 0.09
362 0.1
363 0.1
364 0.11
365 0.13
366 0.13
367 0.11
368 0.12
369 0.11
370 0.18
371 0.21
372 0.21
373 0.2
374 0.2
375 0.27
376 0.35
377 0.43
378 0.46
379 0.5
380 0.5
381 0.52
382 0.57
383 0.53
384 0.5