Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q9UTC2

Protein Details
Accession Q9UTC2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
87-106QEGLRKRRLQQWMKFRQGPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11.333, mito_nucl 10.333, cyto 5.5, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021475  DUF3128  
Gene Ontology GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
KEGG spo:SPAC227.17c  -  
Pfam View protein in Pfam  
PF11326  DUF3128  
Amino Acid Sequences MNNFKENDEKSTFGQYAELDKILDLKKGIPEDPCSLQYYFDQMAMCLTVFSQMNHYYRYGEYNRCKGNFKDFKWCLSTKSKAHEEAQEGLRKRRLQQWMKFRQGPNSEDIWKMRTSPKSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.25
4 0.24
5 0.22
6 0.16
7 0.15
8 0.2
9 0.19
10 0.19
11 0.15
12 0.15
13 0.19
14 0.21
15 0.23
16 0.21
17 0.24
18 0.26
19 0.29
20 0.29
21 0.28
22 0.26
23 0.26
24 0.23
25 0.23
26 0.2
27 0.18
28 0.16
29 0.13
30 0.13
31 0.12
32 0.11
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.1
39 0.13
40 0.15
41 0.16
42 0.17
43 0.16
44 0.16
45 0.2
46 0.2
47 0.24
48 0.28
49 0.33
50 0.36
51 0.36
52 0.39
53 0.36
54 0.43
55 0.44
56 0.42
57 0.47
58 0.44
59 0.45
60 0.48
61 0.47
62 0.41
63 0.4
64 0.45
65 0.37
66 0.43
67 0.44
68 0.43
69 0.45
70 0.45
71 0.41
72 0.4
73 0.42
74 0.41
75 0.39
76 0.4
77 0.44
78 0.41
79 0.41
80 0.43
81 0.49
82 0.52
83 0.59
84 0.65
85 0.69
86 0.76
87 0.8
88 0.74
89 0.73
90 0.7
91 0.64
92 0.57
93 0.52
94 0.46
95 0.42
96 0.42
97 0.36
98 0.31
99 0.32
100 0.35
101 0.38