Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3SAM4

Protein Details
Accession A0A0C3SAM4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
85-116LLRLSRRNLRQKPLQRKQRKILQPRRHEPTNCHydrophilic
NLS Segment(s)
PositionSequence
87-107RLSRRNLRQKPLQRKQRKILQ
Subcellular Location(s) nucl 14, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences PSQHLRLRSLSLRQPPLASPHPRRPNQLQKWQLAPSPPLLLPSLPPRLQQNPHPLLVLKSQHRARVQSLPPKRSPTVLRLQLRPLLRLSRRNLRQKPLQRKQRKILQPRRHEPTNCTSCPLITSASGIAHLGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.48
4 0.5
5 0.51
6 0.5
7 0.55
8 0.63
9 0.65
10 0.7
11 0.73
12 0.76
13 0.76
14 0.78
15 0.75
16 0.69
17 0.71
18 0.66
19 0.59
20 0.51
21 0.43
22 0.34
23 0.3
24 0.26
25 0.22
26 0.2
27 0.17
28 0.16
29 0.2
30 0.24
31 0.22
32 0.23
33 0.26
34 0.31
35 0.34
36 0.38
37 0.42
38 0.39
39 0.39
40 0.39
41 0.34
42 0.3
43 0.32
44 0.31
45 0.24
46 0.28
47 0.29
48 0.33
49 0.35
50 0.35
51 0.33
52 0.37
53 0.39
54 0.42
55 0.47
56 0.47
57 0.48
58 0.51
59 0.48
60 0.44
61 0.42
62 0.38
63 0.4
64 0.43
65 0.44
66 0.41
67 0.43
68 0.44
69 0.43
70 0.39
71 0.32
72 0.31
73 0.32
74 0.37
75 0.4
76 0.45
77 0.53
78 0.62
79 0.66
80 0.65
81 0.71
82 0.74
83 0.8
84 0.8
85 0.82
86 0.82
87 0.85
88 0.87
89 0.87
90 0.87
91 0.87
92 0.87
93 0.87
94 0.87
95 0.87
96 0.86
97 0.85
98 0.78
99 0.73
100 0.72
101 0.71
102 0.61
103 0.56
104 0.48
105 0.4
106 0.38
107 0.34
108 0.25
109 0.17
110 0.17
111 0.15
112 0.15
113 0.15