Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S4U0

Protein Details
Accession A0A0C3S4U0    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
102-121RTWGRTSPARQRRPRARGVWHydrophilic
NLS Segment(s)
PositionSequence
60-72RRTAARGRQPAPR
110-116ARQRRPR
Subcellular Location(s) nucl 12, cyto 6, extr 5, mito 3
Family & Domain DBs
Amino Acid Sequences MAVAGEPTGSAAAVVSSVDTPPLRERQSAFLHNRKLLLPRRDGAPRTVLDSRHTSGPGARRTAARGRQPAPRAAEGPQRTAHERPPAGCARIPPPVYPADRRTWGRTSPARQRRPRARGVWSALTLLRALQGDEPSRNRPTTYMRALHRTRVSPGRSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.05
5 0.08
6 0.09
7 0.11
8 0.16
9 0.22
10 0.24
11 0.27
12 0.29
13 0.33
14 0.4
15 0.46
16 0.5
17 0.52
18 0.55
19 0.54
20 0.54
21 0.49
22 0.5
23 0.5
24 0.49
25 0.45
26 0.41
27 0.44
28 0.49
29 0.49
30 0.43
31 0.39
32 0.33
33 0.34
34 0.35
35 0.32
36 0.29
37 0.31
38 0.3
39 0.28
40 0.27
41 0.22
42 0.23
43 0.28
44 0.29
45 0.27
46 0.27
47 0.25
48 0.29
49 0.36
50 0.39
51 0.39
52 0.41
53 0.41
54 0.46
55 0.48
56 0.49
57 0.45
58 0.4
59 0.34
60 0.3
61 0.36
62 0.3
63 0.3
64 0.28
65 0.26
66 0.27
67 0.27
68 0.29
69 0.27
70 0.27
71 0.25
72 0.28
73 0.29
74 0.27
75 0.27
76 0.25
77 0.22
78 0.27
79 0.27
80 0.22
81 0.22
82 0.25
83 0.27
84 0.3
85 0.3
86 0.28
87 0.33
88 0.36
89 0.39
90 0.38
91 0.37
92 0.41
93 0.44
94 0.47
95 0.52
96 0.59
97 0.64
98 0.69
99 0.77
100 0.8
101 0.8
102 0.81
103 0.77
104 0.73
105 0.71
106 0.7
107 0.65
108 0.55
109 0.5
110 0.42
111 0.36
112 0.29
113 0.21
114 0.17
115 0.11
116 0.11
117 0.11
118 0.15
119 0.17
120 0.23
121 0.27
122 0.3
123 0.35
124 0.35
125 0.34
126 0.34
127 0.38
128 0.41
129 0.46
130 0.47
131 0.48
132 0.57
133 0.59
134 0.64
135 0.63
136 0.58
137 0.56
138 0.58