Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q92398

Protein Details
Accession Q92398    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
349-371DEVLNFRQKVRRRSHPTNPTVNIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR003527  MAP_kinase_CS  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0032153  C:cell division site  
GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0044732  C:mitotic spindle pole body  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0004707  F:MAP kinase activity  
GO:0106310  F:protein serine kinase activity  
GO:0007049  P:cell cycle  
GO:0000196  P:cell wall integrity MAPK cascade  
GO:0035556  P:intracellular signal transduction  
GO:1902660  P:negative regulation of glucose mediated signaling pathway  
GO:1902413  P:negative regulation of mitotic cytokinesis  
GO:1905665  P:positive regulation of calcium ion import across plasma membrane  
GO:0050850  P:positive regulation of calcium-mediated signaling  
GO:1903340  P:positive regulation of cell wall organization or biogenesis  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0006468  P:protein phosphorylation  
GO:0008360  P:regulation of cell shape  
GO:1903338  P:regulation of cell wall organization or biogenesis  
GO:0032995  P:regulation of fungal-type cell wall biogenesis  
KEGG spo:SPBC119.08  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS01351  MAPK  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd07857  STKc_MPK1  
Amino Acid Sequences MDRRHRVYRVFNQEMYVEPNFKVVKELGQGAYGIVCAARNVASKDQEAVAIKKITNVFSKSILTKRALREIKLLIHFRNHRNITCIYDLDIINPYNFNEVYIYEELMEADLNAIIKSGQPLTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCELKICDFGLARGCSENPEENPGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAELLGGTPLFKGKDFVHQLNLILHQLGTPDEETLSHISSSRAQEYVRSLPKQRPIPFETNFPKANPLALDLLAKLLAFDPNRRISVDDALEHPYLAVWHDPSDEPVCDSVFDFSFEYIEDANELRRVILDEVLNFRQKVRRRSHPTNPTVNIPQPAQTVPSNDNGSFNVSSSSSSQTSNKKRHDHSYNETAAIDHKSDDNRHN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.46
3 0.4
4 0.31
5 0.24
6 0.29
7 0.28
8 0.27
9 0.28
10 0.23
11 0.24
12 0.25
13 0.29
14 0.24
15 0.24
16 0.24
17 0.21
18 0.2
19 0.15
20 0.12
21 0.07
22 0.07
23 0.06
24 0.07
25 0.09
26 0.12
27 0.16
28 0.22
29 0.24
30 0.25
31 0.28
32 0.27
33 0.29
34 0.29
35 0.27
36 0.27
37 0.28
38 0.27
39 0.3
40 0.32
41 0.31
42 0.34
43 0.35
44 0.31
45 0.31
46 0.35
47 0.35
48 0.37
49 0.39
50 0.37
51 0.4
52 0.42
53 0.5
54 0.5
55 0.47
56 0.48
57 0.47
58 0.5
59 0.51
60 0.51
61 0.43
62 0.48
63 0.54
64 0.53
65 0.59
66 0.56
67 0.5
68 0.5
69 0.5
70 0.46
71 0.42
72 0.37
73 0.3
74 0.29
75 0.28
76 0.25
77 0.26
78 0.22
79 0.19
80 0.19
81 0.16
82 0.15
83 0.15
84 0.14
85 0.11
86 0.11
87 0.15
88 0.15
89 0.15
90 0.12
91 0.12
92 0.12
93 0.11
94 0.11
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.07
104 0.08
105 0.07
106 0.08
107 0.09
108 0.14
109 0.22
110 0.23
111 0.22
112 0.22
113 0.22
114 0.22
115 0.23
116 0.19
117 0.11
118 0.1
119 0.1
120 0.11
121 0.12
122 0.11
123 0.1
124 0.1
125 0.12
126 0.13
127 0.13
128 0.14
129 0.15
130 0.18
131 0.25
132 0.26
133 0.26
134 0.25
135 0.3
136 0.27
137 0.28
138 0.27
139 0.19
140 0.19
141 0.18
142 0.18
143 0.13
144 0.14
145 0.14
146 0.13
147 0.11
148 0.11
149 0.1
150 0.1
151 0.1
152 0.08
153 0.08
154 0.07
155 0.08
156 0.14
157 0.13
158 0.13
159 0.14
160 0.14
161 0.14
162 0.16
163 0.18
164 0.13
165 0.18
166 0.18
167 0.17
168 0.18
169 0.17
170 0.15
171 0.13
172 0.13
173 0.08
174 0.08
175 0.09
176 0.11
177 0.1
178 0.11
179 0.12
180 0.13
181 0.13
182 0.13
183 0.13
184 0.12
185 0.14
186 0.14
187 0.13
188 0.13
189 0.13
190 0.13
191 0.13
192 0.12
193 0.1
194 0.09
195 0.09
196 0.07
197 0.08
198 0.09
199 0.07
200 0.07
201 0.08
202 0.07
203 0.07
204 0.07
205 0.05
206 0.04
207 0.03
208 0.03
209 0.02
210 0.03
211 0.03
212 0.03
213 0.03
214 0.05
215 0.05
216 0.05
217 0.08
218 0.08
219 0.17
220 0.21
221 0.22
222 0.24
223 0.25
224 0.25
225 0.25
226 0.25
227 0.17
228 0.13
229 0.11
230 0.08
231 0.08
232 0.07
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.08
239 0.09
240 0.09
241 0.09
242 0.09
243 0.1
244 0.14
245 0.16
246 0.16
247 0.16
248 0.15
249 0.17
250 0.21
251 0.28
252 0.29
253 0.3
254 0.33
255 0.37
256 0.44
257 0.5
258 0.51
259 0.51
260 0.51
261 0.55
262 0.53
263 0.57
264 0.54
265 0.51
266 0.48
267 0.41
268 0.38
269 0.31
270 0.31
271 0.22
272 0.2
273 0.16
274 0.15
275 0.15
276 0.11
277 0.12
278 0.1
279 0.09
280 0.07
281 0.06
282 0.1
283 0.1
284 0.13
285 0.18
286 0.22
287 0.23
288 0.23
289 0.24
290 0.23
291 0.27
292 0.27
293 0.23
294 0.21
295 0.24
296 0.24
297 0.22
298 0.19
299 0.14
300 0.12
301 0.11
302 0.11
303 0.08
304 0.09
305 0.11
306 0.11
307 0.14
308 0.17
309 0.16
310 0.16
311 0.16
312 0.16
313 0.14
314 0.15
315 0.14
316 0.11
317 0.13
318 0.12
319 0.11
320 0.11
321 0.11
322 0.12
323 0.09
324 0.09
325 0.08
326 0.08
327 0.1
328 0.11
329 0.11
330 0.1
331 0.1
332 0.12
333 0.12
334 0.15
335 0.16
336 0.16
337 0.22
338 0.26
339 0.29
340 0.27
341 0.29
342 0.33
343 0.39
344 0.46
345 0.49
346 0.56
347 0.62
348 0.72
349 0.8
350 0.83
351 0.85
352 0.85
353 0.79
354 0.75
355 0.72
356 0.67
357 0.6
358 0.5
359 0.45
360 0.37
361 0.35
362 0.31
363 0.27
364 0.27
365 0.25
366 0.31
367 0.32
368 0.3
369 0.31
370 0.28
371 0.31
372 0.27
373 0.25
374 0.21
375 0.17
376 0.18
377 0.19
378 0.23
379 0.19
380 0.22
381 0.28
382 0.36
383 0.45
384 0.53
385 0.6
386 0.64
387 0.69
388 0.76
389 0.79
390 0.78
391 0.77
392 0.77
393 0.73
394 0.65
395 0.59
396 0.5
397 0.44
398 0.38
399 0.3
400 0.22
401 0.22
402 0.26