FuNGI

Q92398

Protein Details

Accession

Q92398

Localization Confidence

Medium

Confidence Score

10.7

NoLS Segment(s)

Position	Sequence	Protein Nature
349-371	DEVLNFRQKVRRRSHPTNPTVNI	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 21.5, cyto_nucl 13, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR003527 MAP_kinase_CS IPR000719 Prot_kinase_dom IPR017441 Protein_kinase_ATP_BS IPR008271 Ser/Thr_kinase_AS
Gene Ontology	GO:0032153 C:cell division site GO:0005737 C:cytoplasm GO:0005829 C:cytosol GO:0044732 C:mitotic spindle pole body GO:0005634 C:nucleus GO:0005524 F:ATP binding GO:0004707 F:MAP kinase activity GO:0106310 F:protein serine kinase activity GO:0007049 P:cell cycle GO:0000196 P:cell wall integrity MAPK cascade GO:0035556 P:intracellular signal transduction GO:1902660 P:negative regulation of glucose mediated signaling pathway GO:1902413 P:negative regulation of mitotic cytokinesis GO:1905665 P:positive regulation of calcium ion import across plasma membrane GO:0050850 P:positive regulation of calcium-mediated signaling GO:1903340 P:positive regulation of cell wall organization or biogenesis GO:0045944 P:positive regulation of transcription by RNA polymerase II GO:0006468 P:protein phosphorylation GO:0008360 P:regulation of cell shape GO:1903338 P:regulation of cell wall organization or biogenesis GO:0032995 P:regulation of fungal-type cell wall biogenesis
KEGG	spo:SPBC119.08 -
Pfam	View protein in Pfam PF00069 Pkinase
PROSITE	View protein in PROSITE PS01351 MAPK PS00107 PROTEIN_KINASE_ATP PS50011 PROTEIN_KINASE_DOM PS00108 PROTEIN_KINASE_ST
CDD	cd07857 STKc_MPK1

Amino Acid Sequences

MDRRHRVYRVFNQEMYVEPNFKVVKELGQGAYGIVCAARNVASKDQEAVAIKKITNVFSKSILTKRALREIKLLIHFRNHRNITCIYDLDIINPYNFNEVYIYEELMEADLNAIIKSGQPLTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCELKICDFGLARGCSENPEENPGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAELLGGTPLFKGKDFVHQLNLILHQLGTPDEETLSHISSSRAQEYVRSLPKQRPIPFETNFPKANPLALDLLAKLLAFDPNRRISVDDALEHPYLAVWHDPSDEPVCDSVFDFSFEYIEDANELRRVILDEVLNFRQKVRRRSHPTNPTVNIPQPAQTVPSNDNGSFNVSSSSSSQTSNKKRHDHSYNETAAIDHKSDDNRHN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.5
2	0.46
3	0.4
4	0.31
5	0.24
6	0.29
7	0.28
8	0.27
9	0.28
10	0.23
11	0.24
12	0.25
13	0.29
14	0.24
15	0.24
16	0.24
17	0.21
18	0.2
19	0.15
20	0.12
21	0.07
22	0.07
23	0.06
24	0.07
25	0.09
26	0.12
27	0.16
28	0.22
29	0.24
30	0.25
31	0.28
32	0.27
33	0.29
34	0.29
35	0.27
36	0.27
37	0.28
38	0.27
39	0.3
40	0.32
41	0.31
42	0.34
43	0.35
44	0.31
45	0.31
46	0.35
47	0.35
48	0.37
49	0.39
50	0.37
51	0.4
52	0.42
53	0.5
54	0.5
55	0.47
56	0.48
57	0.47
58	0.5
59	0.51
60	0.51
61	0.43
62	0.48
63	0.54
64	0.53
65	0.59
66	0.56
67	0.5
68	0.5
69	0.5
70	0.46
71	0.42
72	0.37
73	0.3
74	0.29
75	0.28
76	0.25
77	0.26
78	0.22
79	0.19
80	0.19
81	0.16
82	0.15
83	0.15
84	0.14
85	0.11
86	0.11
87	0.15
88	0.15
89	0.15
90	0.12
91	0.12
92	0.12
93	0.11
94	0.11
95	0.05
96	0.05
97	0.05
98	0.05
99	0.05
100	0.05
101	0.05
102	0.05
103	0.07
104	0.08
105	0.07
106	0.08
107	0.09
108	0.14
109	0.22
110	0.23
111	0.22
112	0.22
113	0.22
114	0.22
115	0.23
116	0.19
117	0.11
118	0.1
119	0.1
120	0.11
121	0.12
122	0.11
123	0.1
124	0.1
125	0.12
126	0.13
127	0.13
128	0.14
129	0.15
130	0.18
131	0.25
132	0.26
133	0.26
134	0.25
135	0.3
136	0.27
137	0.28
138	0.27
139	0.19
140	0.19
141	0.18
142	0.18
143	0.13
144	0.14
145	0.14
146	0.13
147	0.11
148	0.11
149	0.1
150	0.1
151	0.1
152	0.08
153	0.08
154	0.07
155	0.08
156	0.14
157	0.13
158	0.13
159	0.14
160	0.14
161	0.14
162	0.16
163	0.18
164	0.13
165	0.18
166	0.18
167	0.17
168	0.18
169	0.17
170	0.15
171	0.13
172	0.13
173	0.08
174	0.08
175	0.09
176	0.11
177	0.1
178	0.11
179	0.12
180	0.13
181	0.13
182	0.13
183	0.13
184	0.12
185	0.14
186	0.14
187	0.13
188	0.13
189	0.13
190	0.13
191	0.13
192	0.12
193	0.1
194	0.09
195	0.09
196	0.07
197	0.08
198	0.09
199	0.07
200	0.07
201	0.08
202	0.07
203	0.07
204	0.07
205	0.05
206	0.04
207	0.03
208	0.03
209	0.02
210	0.03
211	0.03
212	0.03
213	0.03
214	0.05
215	0.05
216	0.05
217	0.08
218	0.08
219	0.17
220	0.21
221	0.22
222	0.24
223	0.25
224	0.25
225	0.25
226	0.25
227	0.17
228	0.13
229	0.11
230	0.08
231	0.08
232	0.07
233	0.07
234	0.06
235	0.06
236	0.06
237	0.06
238	0.08
239	0.09
240	0.09
241	0.09
242	0.09
243	0.1
244	0.14
245	0.16
246	0.16
247	0.16
248	0.15
249	0.17
250	0.21
251	0.28
252	0.29
253	0.3
254	0.33
255	0.37
256	0.44
257	0.5
258	0.51
259	0.51
260	0.51
261	0.55
262	0.53
263	0.57
264	0.54
265	0.51
266	0.48
267	0.41
268	0.38
269	0.31
270	0.31
271	0.22
272	0.2
273	0.16
274	0.15
275	0.15
276	0.11
277	0.12
278	0.1
279	0.09
280	0.07
281	0.06
282	0.1
283	0.1
284	0.13
285	0.18
286	0.22
287	0.23
288	0.23
289	0.24
290	0.23
291	0.27
292	0.27
293	0.23
294	0.21
295	0.24
296	0.24
297	0.22
298	0.19
299	0.14
300	0.12
301	0.11
302	0.11
303	0.08
304	0.09
305	0.11
306	0.11
307	0.14
308	0.17
309	0.16
310	0.16
311	0.16
312	0.16
313	0.14
314	0.15
315	0.14
316	0.11
317	0.13
318	0.12
319	0.11
320	0.11
321	0.11
322	0.12
323	0.09
324	0.09
325	0.08
326	0.08
327	0.1
328	0.11
329	0.11
330	0.1
331	0.1
332	0.12
333	0.12
334	0.15
335	0.16
336	0.16
337	0.22
338	0.26
339	0.29
340	0.27
341	0.29
342	0.33
343	0.39
344	0.46
345	0.49
346	0.56
347	0.62
348	0.72
349	0.8
350	0.83
351	0.85
352	0.85
353	0.79
354	0.75
355	0.72
356	0.67
357	0.6
358	0.5
359	0.45
360	0.37
361	0.35
362	0.31
363	0.27
364	0.27
365	0.25
366	0.31
367	0.32
368	0.3
369	0.31
370	0.28
371	0.31
372	0.27
373	0.25
374	0.21
375	0.17
376	0.18
377	0.19
378	0.23
379	0.19
380	0.22
381	0.28
382	0.36
383	0.45
384	0.53
385	0.6
386	0.64
387	0.69
388	0.76
389	0.79
390	0.78
391	0.77
392	0.77
393	0.73
394	0.65
395	0.59
396	0.5
397	0.44
398	0.38
399	0.3
400	0.22
401	0.22
402	0.26

Q92398

3D AlphaFold-predicted Structure Viewer