Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S4M3

Protein Details
Accession A0A0C3S4M3   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-31RTWGRVTSSWRRQPHHRRRTTRGGVLHHydrophilic
NLS Segment(s)
PositionSequence
21-23RRR
46-46R
50-53GRRR
Subcellular Location(s) mito 15, nucl 7, cyto_nucl 6.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSGCRTWGRVTSSWRRQPHHRRRTTRGGVLHRVLMRARTLALQRPRPTLGRRRVALRRLPPLLWVWSCAPPFQFGSPTHRDPIRQIWRPPPQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.73
4 0.79
5 0.82
6 0.82
7 0.82
8 0.82
9 0.83
10 0.88
11 0.85
12 0.81
13 0.78
14 0.75
15 0.71
16 0.63
17 0.6
18 0.5
19 0.44
20 0.37
21 0.3
22 0.23
23 0.17
24 0.16
25 0.14
26 0.15
27 0.2
28 0.26
29 0.32
30 0.33
31 0.36
32 0.37
33 0.38
34 0.41
35 0.44
36 0.46
37 0.46
38 0.45
39 0.49
40 0.54
41 0.56
42 0.59
43 0.56
44 0.54
45 0.5
46 0.48
47 0.43
48 0.39
49 0.38
50 0.3
51 0.27
52 0.23
53 0.25
54 0.25
55 0.25
56 0.23
57 0.2
58 0.22
59 0.21
60 0.23
61 0.2
62 0.27
63 0.33
64 0.35
65 0.38
66 0.38
67 0.38
68 0.38
69 0.47
70 0.5
71 0.51
72 0.54
73 0.6