Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P87176

Protein Details
Accession P87176    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
237-259TAATQKCPVCRRKVHPNKVICLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR017907  Znf_RING_CS  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0033768  C:SUMO-targeted ubiquitin ligase complex  
GO:0140082  F:SUMO-ubiquitin ligase activity  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0008270  F:zinc ion binding  
GO:0006310  P:DNA recombination  
GO:0016567  P:protein ubiquitination  
GO:0120290  P:stalled replication fork localization to nuclear periphery  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
KEGG spo:SPBC3D6.11c  -  
Pfam View protein in Pfam  
PF13920  zf-C3HC4_3  
PROSITE View protein in PROSITE  
PS00518  ZF_RING_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MPPAHKRDTNVRNLSAPYNIPSQSARVAAGNAAINRRRSSPVENSPGNGFPVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDINFQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPSTTNAEIEKEEPSKKQVVPSSQRLADYKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVICLEMMLGSQKKKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.42
4 0.34
5 0.32
6 0.29
7 0.27
8 0.26
9 0.26
10 0.25
11 0.24
12 0.22
13 0.18
14 0.18
15 0.16
16 0.18
17 0.19
18 0.18
19 0.24
20 0.27
21 0.29
22 0.3
23 0.33
24 0.35
25 0.35
26 0.4
27 0.42
28 0.48
29 0.52
30 0.52
31 0.51
32 0.5
33 0.47
34 0.42
35 0.32
36 0.23
37 0.15
38 0.17
39 0.16
40 0.13
41 0.13
42 0.12
43 0.15
44 0.15
45 0.15
46 0.12
47 0.11
48 0.12
49 0.11
50 0.11
51 0.12
52 0.14
53 0.14
54 0.15
55 0.16
56 0.16
57 0.18
58 0.21
59 0.19
60 0.18
61 0.21
62 0.22
63 0.25
64 0.3
65 0.31
66 0.29
67 0.3
68 0.31
69 0.29
70 0.28
71 0.25
72 0.18
73 0.15
74 0.14
75 0.1
76 0.08
77 0.07
78 0.06
79 0.06
80 0.05
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.06
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.1
108 0.09
109 0.11
110 0.12
111 0.12
112 0.12
113 0.13
114 0.2
115 0.23
116 0.24
117 0.23
118 0.24
119 0.24
120 0.26
121 0.27
122 0.2
123 0.13
124 0.12
125 0.12
126 0.11
127 0.11
128 0.09
129 0.07
130 0.07
131 0.07
132 0.08
133 0.07
134 0.07
135 0.07
136 0.09
137 0.12
138 0.11
139 0.1
140 0.09
141 0.09
142 0.09
143 0.09
144 0.07
145 0.05
146 0.05
147 0.05
148 0.06
149 0.08
150 0.1
151 0.15
152 0.21
153 0.23
154 0.28
155 0.3
156 0.39
157 0.47
158 0.55
159 0.6
160 0.64
161 0.69
162 0.67
163 0.67
164 0.59
165 0.51
166 0.42
167 0.35
168 0.29
169 0.23
170 0.2
171 0.2
172 0.22
173 0.23
174 0.24
175 0.22
176 0.22
177 0.26
178 0.26
179 0.31
180 0.32
181 0.38
182 0.43
183 0.5
184 0.52
185 0.5
186 0.51
187 0.47
188 0.45
189 0.41
190 0.39
191 0.32
192 0.28
193 0.26
194 0.24
195 0.22
196 0.23
197 0.2
198 0.19
199 0.2
200 0.18
201 0.2
202 0.2
203 0.21
204 0.18
205 0.16
206 0.15
207 0.16
208 0.18
209 0.18
210 0.23
211 0.24
212 0.25
213 0.31
214 0.28
215 0.26
216 0.24
217 0.23
218 0.18
219 0.15
220 0.15
221 0.08
222 0.09
223 0.09
224 0.14
225 0.14
226 0.14
227 0.17
228 0.2
229 0.27
230 0.36
231 0.43
232 0.46
233 0.56
234 0.63
235 0.72
236 0.8
237 0.82
238 0.82
239 0.83
240 0.82
241 0.78
242 0.72
243 0.61
244 0.51
245 0.41
246 0.33
247 0.27
248 0.26
249 0.24