FuNGI

A0A0C3PJQ3

Protein Details

Accession

A0A0C3PJQ3

Localization Confidence

High

Confidence Score

16.1

NoLS Segment(s)

Position	Sequence	Protein Nature
238-265	PTVPSQKAPRPKTRRTRRTKDTVPQPDA	Hydrophilic

NLS Segment(s)

Position	Sequence
244-257	KAPRPKTRRTRRTK

Subcellular Location(s)

nucl 21, cyto 3, mito 2

Family & Domain DBs

InterPro	View protein in InterPro IPR036910 HMG_box_dom_sf

Amino Acid Sequences

MTLISATDYSNTAYNSVQGTTHCIYPLNNVSQACKNPATWQDPSVMYHLEPTHQEDGFHLEDLIPLGDDEFDELFNKEALQQSIAHNCGLPIALPIAHPVPCPGSMVASRSPLHYPPSNATTPSPGPYDQISHSRHNRRFSPYSLPPTASLPQDRSHRFLISPSPPSIPLDFSTYSVKPQSLTKTSAVPSHTSRRMKTKQNYLFQDLSHGFPPSSSPMLTPRNPSHYPTRSDGLVIAPTVPSQKAPRPKTRRTRRTKDTVPQPDAPIKPKKGPNCYLRYKARVEKFLQDRSTYGMSAGTSTLVASRLWHMLSEEAREPWRAEYDRGQPHVKFALPAGACAFDEVPLLDVIEALRHEVRAAVDPQAFEPHLNAVRRQRARYRAEDVGRAWHMELVRERLWIVHKERAGVEGNVSPVFTIDDLLRTEKDLTEWLL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.17
3	0.17
4	0.17
5	0.15
6	0.21
7	0.22
8	0.23
9	0.21
10	0.21
11	0.21
12	0.27
13	0.33
14	0.31
15	0.34
16	0.33
17	0.36
18	0.42
19	0.44
20	0.43
21	0.38
22	0.34
23	0.36
24	0.43
25	0.45
26	0.41
27	0.39
28	0.39
29	0.38
30	0.39
31	0.35
32	0.29
33	0.23
34	0.25
35	0.24
36	0.22
37	0.22
38	0.26
39	0.28
40	0.27
41	0.27
42	0.22
43	0.27
44	0.26
45	0.24
46	0.19
47	0.14
48	0.14
49	0.15
50	0.14
51	0.08
52	0.07
53	0.06
54	0.06
55	0.06
56	0.07
57	0.07
58	0.07
59	0.08
60	0.09
61	0.1
62	0.1
63	0.1
64	0.1
65	0.14
66	0.15
67	0.15
68	0.17
69	0.2
70	0.26
71	0.27
72	0.25
73	0.21
74	0.19
75	0.18
76	0.16
77	0.13
78	0.07
79	0.07
80	0.08
81	0.08
82	0.1
83	0.11
84	0.12
85	0.12
86	0.12
87	0.13
88	0.13
89	0.15
90	0.13
91	0.14
92	0.15
93	0.18
94	0.19
95	0.22
96	0.22
97	0.22
98	0.25
99	0.23
100	0.27
101	0.27
102	0.28
103	0.27
104	0.32
105	0.32
106	0.31
107	0.3
108	0.3
109	0.28
110	0.28
111	0.26
112	0.21
113	0.21
114	0.2
115	0.22
116	0.2
117	0.26
118	0.28
119	0.34
120	0.42
121	0.51
122	0.55
123	0.59
124	0.62
125	0.62
126	0.62
127	0.58
128	0.58
129	0.55
130	0.57
131	0.53
132	0.49
133	0.42
134	0.41
135	0.4
136	0.34
137	0.29
138	0.24
139	0.26
140	0.33
141	0.34
142	0.34
143	0.34
144	0.32
145	0.3
146	0.29
147	0.32
148	0.29
149	0.31
150	0.29
151	0.28
152	0.27
153	0.29
154	0.28
155	0.22
156	0.18
157	0.18
158	0.17
159	0.17
160	0.21
161	0.19
162	0.2
163	0.2
164	0.19
165	0.15
166	0.18
167	0.22
168	0.21
169	0.25
170	0.24
171	0.26
172	0.27
173	0.3
174	0.28
175	0.25
176	0.26
177	0.3
178	0.37
179	0.36
180	0.38
181	0.44
182	0.49
183	0.56
184	0.58
185	0.62
186	0.62
187	0.67
188	0.69
189	0.65
190	0.6
191	0.5
192	0.48
193	0.39
194	0.32
195	0.24
196	0.21
197	0.15
198	0.13
199	0.14
200	0.11
201	0.11
202	0.1
203	0.09
204	0.15
205	0.2
206	0.22
207	0.26
208	0.26
209	0.32
210	0.33
211	0.35
212	0.38
213	0.38
214	0.4
215	0.38
216	0.38
217	0.31
218	0.3
219	0.28
220	0.2
221	0.16
222	0.12
223	0.09
224	0.07
225	0.07
226	0.08
227	0.08
228	0.08
229	0.1
230	0.16
231	0.25
232	0.32
233	0.42
234	0.5
235	0.6
236	0.69
237	0.78
238	0.83
239	0.84
240	0.88
241	0.85
242	0.86
243	0.85
244	0.83
245	0.83
246	0.82
247	0.77
248	0.7
249	0.65
250	0.61
251	0.55
252	0.53
253	0.5
254	0.43
255	0.45
256	0.47
257	0.51
258	0.53
259	0.59
260	0.61
261	0.62
262	0.66
263	0.67
264	0.68
265	0.66
266	0.64
267	0.64
268	0.61
269	0.59
270	0.55
271	0.55
272	0.55
273	0.57
274	0.54
275	0.46
276	0.41
277	0.39
278	0.37
279	0.28
280	0.22
281	0.16
282	0.13
283	0.13
284	0.12
285	0.09
286	0.07
287	0.07
288	0.07
289	0.07
290	0.07
291	0.07
292	0.09
293	0.1
294	0.1
295	0.11
296	0.11
297	0.13
298	0.15
299	0.17
300	0.17
301	0.18
302	0.19
303	0.2
304	0.21
305	0.19
306	0.24
307	0.22
308	0.23
309	0.28
310	0.35
311	0.41
312	0.45
313	0.48
314	0.42
315	0.43
316	0.44
317	0.38
318	0.3
319	0.23
320	0.26
321	0.21
322	0.22
323	0.2
324	0.17
325	0.17
326	0.17
327	0.17
328	0.09
329	0.09
330	0.08
331	0.08
332	0.07
333	0.07
334	0.06
335	0.06
336	0.06
337	0.07
338	0.07
339	0.09
340	0.09
341	0.09
342	0.09
343	0.11
344	0.12
345	0.15
346	0.17
347	0.19
348	0.2
349	0.21
350	0.22
351	0.25
352	0.24
353	0.2
354	0.19
355	0.2
356	0.24
357	0.26
358	0.3
359	0.35
360	0.44
361	0.5
362	0.56
363	0.59
364	0.62
365	0.68
366	0.69
367	0.67
368	0.66
369	0.65
370	0.64
371	0.57
372	0.55
373	0.49
374	0.44
375	0.37
376	0.31
377	0.28
378	0.27
379	0.3
380	0.28
381	0.28
382	0.27
383	0.27
384	0.27
385	0.32
386	0.34
387	0.35
388	0.37
389	0.37
390	0.4
391	0.4
392	0.41
393	0.4
394	0.33
395	0.31
396	0.26
397	0.27
398	0.24
399	0.23
400	0.18
401	0.15
402	0.15
403	0.12
404	0.11
405	0.09
406	0.12
407	0.14
408	0.17
409	0.18
410	0.19
411	0.21
412	0.2
413	0.21

A0A0C3PJQ3

3D AlphaFold-predicted Structure Viewer