FuNGI

A0A0C3SDC4

Protein Details

Accession

A0A0C3SDC4

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
240-260	DTPAKSKKAAKAKTRRKWGDE	Basic

NLS Segment(s)

Position	Sequence
206-224	RLRGKGAISGGARKGPRGG
243-256	AKSKKAAKAKTRRK

Subcellular Location(s)

mito 11.5, cyto_mito 11.5, cyto 10.5, extr 4

Family & Domain DBs

InterPro	View protein in InterPro IPR003593 AAA+_ATPase IPR011012 Longin-like_dom_sf IPR027417 P-loop_NTPase IPR007222 Sig_recog_particle_rcpt_asu_N IPR036225 SRP/SRP_N IPR000897 SRP54_GTPase_dom IPR042101 SRP54_N_sf
Gene Ontology	GO:0005785 C:signal recognition particle receptor complex GO:0005525 F:GTP binding GO:0003924 F:GTPase activity GO:0005047 F:signal recognition particle binding GO:0006614 P:SRP-dependent cotranslational protein targeting to membrane
Pfam	View protein in Pfam PF04086 SRP-alpha_N PF00448 SRP54
PROSITE	View protein in PROSITE PS00300 SRP54
CDD	cd14826 SR_alpha_SRX cd17876 SRalpha_C

Amino Acid Sequences

MLDHCSISHKGGVVLWSRSFTPAASQTAGSSISPVNSLIRDALIEGRSAESQFEKDGYALKWTFANDLGLIFVRILQLSYVDELLAALKALFVKLFQPFLTTFVASLQTSSSASLKAASTGSETIFSWDFARAFEKWDSVFDNLLKTIEAKAAQDRKFRLKPSASVHTPAEASPPSDDQSTIPSQSNAATVDEEQIARNVQALKNRLRGKGAISGGARKGPRGGGGAGSGLDSVPGSDSDTPAKSKKAAKAKTRRKWGDEAPSESDMASLDFSYVQVDSPSSERTYTDVSALVDQASLGTRTSEGMYEVKDWEFGATSAANATAPDKTLTQADLAPVLEGMKQHLMKKNVAKEISEKVVEGVGEDLVGRRISGWGGTNTAVRTALSAALTRILTPKTSTDLLLSIRTKISESQSSMIGSTGKKEPYSIVFVGVNGVGKSTNLSKVCFWLVQNGMRVLIAACDTFRSGAVEQLRVHVRNLSMLGVNGATDSKGRVELYERGYGKDAAGIAKEAISYGKEHDFDVVLIDTAGRMQDNEPLMRALAKLVATNSPDKILFVGEALVGNEAVDQLTKFDRALRDFSAASGGAYGSGGGSGKERGIDGMIVTKWDTVDDKVGAALSMTYVTGQPIVFVGCGQTYTDLRQLRVSNVVQAILDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.28
3	0.27
4	0.27
5	0.28
6	0.27
7	0.22
8	0.24
9	0.24
10	0.27
11	0.27
12	0.26
13	0.25
14	0.26
15	0.27
16	0.2
17	0.18
18	0.15
19	0.13
20	0.14
21	0.14
22	0.15
23	0.14
24	0.15
25	0.14
26	0.13
27	0.12
28	0.13
29	0.17
30	0.15
31	0.15
32	0.15
33	0.16
34	0.17
35	0.17
36	0.18
37	0.15
38	0.16
39	0.17
40	0.17
41	0.16
42	0.15
43	0.19
44	0.18
45	0.23
46	0.22
47	0.22
48	0.23
49	0.23
50	0.25
51	0.21
52	0.22
53	0.15
54	0.14
55	0.15
56	0.13
57	0.13
58	0.11
59	0.1
60	0.09
61	0.09
62	0.09
63	0.08
64	0.08
65	0.09
66	0.1
67	0.1
68	0.08
69	0.08
70	0.08
71	0.09
72	0.08
73	0.06
74	0.05
75	0.05
76	0.06
77	0.07
78	0.06
79	0.06
80	0.09
81	0.12
82	0.14
83	0.13
84	0.16
85	0.16
86	0.19
87	0.21
88	0.19
89	0.16
90	0.16
91	0.19
92	0.16
93	0.16
94	0.13
95	0.12
96	0.12
97	0.13
98	0.13
99	0.1
100	0.11
101	0.12
102	0.12
103	0.12
104	0.12
105	0.11
106	0.13
107	0.13
108	0.14
109	0.13
110	0.13
111	0.15
112	0.15
113	0.15
114	0.13
115	0.15
116	0.14
117	0.14
118	0.17
119	0.14
120	0.18
121	0.18
122	0.2
123	0.18
124	0.2
125	0.21
126	0.2
127	0.22
128	0.19
129	0.2
130	0.18
131	0.18
132	0.16
133	0.14
134	0.13
135	0.13
136	0.14
137	0.13
138	0.21
139	0.29
140	0.33
141	0.39
142	0.42
143	0.49
144	0.53
145	0.55
146	0.55
147	0.51
148	0.53
149	0.54
150	0.59
151	0.53
152	0.51
153	0.49
154	0.42
155	0.38
156	0.32
157	0.28
158	0.19
159	0.18
160	0.16
161	0.16
162	0.16
163	0.16
164	0.16
165	0.13
166	0.17
167	0.18
168	0.19
169	0.18
170	0.17
171	0.17
172	0.17
173	0.18
174	0.15
175	0.13
176	0.12
177	0.11
178	0.13
179	0.13
180	0.13
181	0.11
182	0.11
183	0.11
184	0.1
185	0.12
186	0.13
187	0.14
188	0.19
189	0.24
190	0.29
191	0.36
192	0.41
193	0.41
194	0.4
195	0.39
196	0.37
197	0.39
198	0.35
199	0.32
200	0.28
201	0.3
202	0.29
203	0.32
204	0.29
205	0.22
206	0.23
207	0.18
208	0.19
209	0.17
210	0.16
211	0.12
212	0.13
213	0.13
214	0.11
215	0.11
216	0.09
217	0.06
218	0.06
219	0.05
220	0.04
221	0.04
222	0.04
223	0.06
224	0.06
225	0.08
226	0.1
227	0.12
228	0.14
229	0.16
230	0.17
231	0.2
232	0.25
233	0.31
234	0.39
235	0.46
236	0.53
237	0.63
238	0.72
239	0.77
240	0.82
241	0.81
242	0.76
243	0.74
244	0.7
245	0.7
246	0.64
247	0.61
248	0.54
249	0.49
250	0.44
251	0.38
252	0.31
253	0.2
254	0.15
255	0.1
256	0.06
257	0.05
258	0.05
259	0.05
260	0.05
261	0.05
262	0.05
263	0.05
264	0.05
265	0.06
266	0.07
267	0.09
268	0.09
269	0.09
270	0.09
271	0.11
272	0.14
273	0.13
274	0.13
275	0.12
276	0.12
277	0.12
278	0.12
279	0.1
280	0.07
281	0.07
282	0.06
283	0.05
284	0.05
285	0.05
286	0.05
287	0.05
288	0.05
289	0.06
290	0.06
291	0.07
292	0.07
293	0.08
294	0.09
295	0.1
296	0.1
297	0.1
298	0.09
299	0.08
300	0.08
301	0.07
302	0.07
303	0.06
304	0.05
305	0.05
306	0.05
307	0.05
308	0.05
309	0.05
310	0.05
311	0.05
312	0.06
313	0.06
314	0.07
315	0.07
316	0.08
317	0.08
318	0.08
319	0.08
320	0.08
321	0.08
322	0.07
323	0.07
324	0.06
325	0.06
326	0.06
327	0.07
328	0.09
329	0.11
330	0.15
331	0.2
332	0.22
333	0.26
334	0.31
335	0.36
336	0.37
337	0.37
338	0.34
339	0.32
340	0.33
341	0.31
342	0.26
343	0.21
344	0.16
345	0.15
346	0.14
347	0.11
348	0.08
349	0.05
350	0.05
351	0.05
352	0.05
353	0.05
354	0.05
355	0.05
356	0.05
357	0.05
358	0.05
359	0.06
360	0.08
361	0.08
362	0.1
363	0.1
364	0.12
365	0.11
366	0.12
367	0.11
368	0.09
369	0.09
370	0.08
371	0.08
372	0.07
373	0.08
374	0.07
375	0.09
376	0.09
377	0.09
378	0.11
379	0.1
380	0.1
381	0.11
382	0.12
383	0.13
384	0.14
385	0.14
386	0.13
387	0.14
388	0.15
389	0.19
390	0.19
391	0.17
392	0.16
393	0.16
394	0.16
395	0.17
396	0.19
397	0.19
398	0.2
399	0.2
400	0.21
401	0.21
402	0.2
403	0.18
404	0.17
405	0.12
406	0.13
407	0.16
408	0.16
409	0.16
410	0.16
411	0.17
412	0.18
413	0.23
414	0.2
415	0.18
416	0.17
417	0.17
418	0.17
419	0.16
420	0.14
421	0.08
422	0.08
423	0.06
424	0.06
425	0.08
426	0.09
427	0.14
428	0.15
429	0.16
430	0.17
431	0.19
432	0.21
433	0.22
434	0.2
435	0.2
436	0.22
437	0.24
438	0.27
439	0.25
440	0.23
441	0.21
442	0.21
443	0.14
444	0.12
445	0.09
446	0.06
447	0.06
448	0.06
449	0.07
450	0.07
451	0.07
452	0.09
453	0.09
454	0.14
455	0.16
456	0.19
457	0.19
458	0.23
459	0.28
460	0.26
461	0.26
462	0.24
463	0.22
464	0.21
465	0.21
466	0.18
467	0.14
468	0.13
469	0.13
470	0.1
471	0.1
472	0.08
473	0.07
474	0.06
475	0.06
476	0.07
477	0.07
478	0.09
479	0.09
480	0.1
481	0.14
482	0.19
483	0.23
484	0.3
485	0.3
486	0.3
487	0.32
488	0.32
489	0.28
490	0.24
491	0.21
492	0.14
493	0.14
494	0.13
495	0.11
496	0.11
497	0.11
498	0.09
499	0.08
500	0.08
501	0.08
502	0.11
503	0.15
504	0.15
505	0.15
506	0.16
507	0.16
508	0.15
509	0.16
510	0.14
511	0.1
512	0.09
513	0.08
514	0.07
515	0.07
516	0.07
517	0.05
518	0.06
519	0.06
520	0.12
521	0.15
522	0.16
523	0.16
524	0.17
525	0.17
526	0.17
527	0.16
528	0.12
529	0.12
530	0.11
531	0.12
532	0.13
533	0.16
534	0.18
535	0.21
536	0.21
537	0.21
538	0.2
539	0.19
540	0.18
541	0.15
542	0.13
543	0.1
544	0.1
545	0.08
546	0.09
547	0.09
548	0.09
549	0.07
550	0.07
551	0.07
552	0.06
553	0.06
554	0.06
555	0.05
556	0.07
557	0.09
558	0.1
559	0.1
560	0.15
561	0.2
562	0.23
563	0.27
564	0.28
565	0.3
566	0.29
567	0.29
568	0.28
569	0.23
570	0.2
571	0.16
572	0.13
573	0.09
574	0.09
575	0.09
576	0.05
577	0.06
578	0.06
579	0.06
580	0.07
581	0.08
582	0.09
583	0.1
584	0.1
585	0.1
586	0.11
587	0.12
588	0.11
589	0.15
590	0.15
591	0.15
592	0.16
593	0.16
594	0.15
595	0.16
596	0.17
597	0.14
598	0.18
599	0.18
600	0.17
601	0.17
602	0.17
603	0.15
604	0.13
605	0.11
606	0.07
607	0.07
608	0.07
609	0.07
610	0.07
611	0.08
612	0.1
613	0.09
614	0.09
615	0.09
616	0.1
617	0.1
618	0.09
619	0.1
620	0.09
621	0.1
622	0.1
623	0.13
624	0.14
625	0.17
626	0.25
627	0.26
628	0.27
629	0.33
630	0.35
631	0.34
632	0.4
633	0.38
634	0.37
635	0.35
636	0.35

A0A0C3SDC4

3D AlphaFold-predicted Structure Viewer