Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S209

Protein Details
Accession A0A0C3S209    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-87HRHQGGNQKPKEKNRAKRRSSQPABasic
NLS Segment(s)
PositionSequence
71-84QKPKEKNRAKRRSS
Subcellular Location(s) mito 6pero 6, extr 5, cyto 4.5, cysk 4, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036412  HAD-like_sf  
IPR023214  HAD_sf  
Amino Acid Sequences MSDTPALDALRDVDVFFFDVFGTVLDWRSGVAHELADRFGGDVDWTQFATEWREGYMALLCAAHRHQGGNQKPKEKNRAKRRSSQPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.06
15 0.07
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.1
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.1
43 0.11
44 0.08
45 0.07
46 0.07
47 0.07
48 0.09
49 0.09
50 0.12
51 0.11
52 0.12
53 0.16
54 0.25
55 0.34
56 0.43
57 0.49
58 0.55
59 0.62
60 0.7
61 0.77
62 0.78
63 0.8
64 0.81
65 0.85
66 0.84
67 0.87