Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3RWG6

Protein Details
Accession A0A0C3RWG6    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-174AWPASLCRRARSRRRVRLSRSGRPRCVDHydrophilic
NLS Segment(s)
PositionSequence
155-167RARSRRRVRLSRS
Subcellular Location(s) mito 15, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MPRPDWLSTPPRPHHATFTYPGSLSRFLFIQQLVIDYPSSSRSRRVSATAHSRCSFRPRISVASRPAVQSFSSATRLFVNSASPTRQLSHNAQRSYSAALAFAARASNRRRTERRLRDEAWPAFVSQPSLPATPVRRCRRVRLQSGAWPASLCRRARSRRRVRLSRSGRPRCVDVVFARVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.54
4 0.48
5 0.48
6 0.44
7 0.39
8 0.39
9 0.35
10 0.33
11 0.28
12 0.24
13 0.2
14 0.17
15 0.2
16 0.18
17 0.16
18 0.13
19 0.14
20 0.13
21 0.13
22 0.13
23 0.1
24 0.11
25 0.13
26 0.16
27 0.16
28 0.21
29 0.23
30 0.27
31 0.29
32 0.33
33 0.32
34 0.37
35 0.47
36 0.47
37 0.5
38 0.47
39 0.47
40 0.44
41 0.48
42 0.47
43 0.38
44 0.38
45 0.36
46 0.42
47 0.45
48 0.49
49 0.46
50 0.45
51 0.45
52 0.4
53 0.37
54 0.31
55 0.26
56 0.21
57 0.18
58 0.15
59 0.17
60 0.16
61 0.16
62 0.16
63 0.16
64 0.16
65 0.14
66 0.13
67 0.12
68 0.13
69 0.14
70 0.14
71 0.14
72 0.15
73 0.16
74 0.18
75 0.22
76 0.3
77 0.36
78 0.35
79 0.34
80 0.34
81 0.33
82 0.31
83 0.26
84 0.17
85 0.1
86 0.09
87 0.09
88 0.08
89 0.08
90 0.06
91 0.06
92 0.1
93 0.14
94 0.22
95 0.27
96 0.35
97 0.4
98 0.48
99 0.59
100 0.65
101 0.7
102 0.69
103 0.67
104 0.66
105 0.7
106 0.63
107 0.56
108 0.46
109 0.38
110 0.32
111 0.3
112 0.25
113 0.16
114 0.18
115 0.15
116 0.15
117 0.15
118 0.18
119 0.23
120 0.29
121 0.39
122 0.44
123 0.51
124 0.54
125 0.63
126 0.69
127 0.74
128 0.74
129 0.73
130 0.71
131 0.69
132 0.75
133 0.67
134 0.57
135 0.47
136 0.4
137 0.4
138 0.4
139 0.33
140 0.31
141 0.39
142 0.49
143 0.59
144 0.69
145 0.72
146 0.77
147 0.86
148 0.9
149 0.89
150 0.9
151 0.89
152 0.88
153 0.88
154 0.88
155 0.85
156 0.79
157 0.74
158 0.68
159 0.61
160 0.57
161 0.48