Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P40921

Protein Details
Accession P40921   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
221-249EAAPAKKAEKKKDEKKKNAPKPQAERPAKBasic
NLS Segment(s)
PositionSequence
220-253KEAAPAKKAEKKKDEKKKNAPKPQAERPAKPPKH
Subcellular Location(s) cyto 13, mito 6, extr 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001662  EF1B_G_C  
IPR036433  EF1B_G_C_sf  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR040079  Glutathione_S-Trfase  
IPR004045  Glutathione_S-Trfase_N  
IPR004046  GST_C  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005829  C:cytosol  
GO:0005634  C:nucleus  
GO:0003746  F:translation elongation factor activity  
GO:0002182  P:cytoplasmic translational elongation  
GO:0006414  P:translational elongation  
KEGG spo:SPAC29A4.02c  -  
Pfam View protein in Pfam  
PF00647  EF1G  
PF00043  GST_C  
PF02798  GST_N  
PROSITE View protein in PROSITE  
PS50040  EF1G_C  
PS50405  GST_CTER  
PS50404  GST_NTER  
CDD cd03181  GST_C_EF1Bgamma_like  
cd03044  GST_N_EF1Bgamma  
Amino Acid Sequences MSVGTVYGKIGSPRVLFCVSVAAVAGVEVEHVDVQPHNFPADLAAKFPLQKMPVFVGKDGFPLSETLAIAFYLASLNKTRALNGTTAEEKAKVLQYCSFTNSELPGAFRPIIAPRVFGAPYDEQAAKEAETAIALIFARFDEELASKTYLVGSRLTLADIFFTCFLKFGATYVLTKSYLAKYTHIYRYYQTIYHQAKLDAITEPLKFIDQPLPIIKAENKEAAPAKKAEKKKDEKKKNAPKPQAERPAKPPKHPLASAPNGSFDIEEYKRVYSNQDTRSGALPWFFEHFDPENYSVWKVDYSYPEDLKQPVFMTNNLIGGFFQRLEASRKYIFGCCVVIGENGDNTITGAFVIKGHDYVPAFDVAPDWGSYTFTKLDINKPEDKAFIEDAWAWDKPIEGREVADGKVCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.23
5 0.26
6 0.21
7 0.19
8 0.17
9 0.13
10 0.11
11 0.1
12 0.1
13 0.05
14 0.04
15 0.04
16 0.05
17 0.05
18 0.05
19 0.07
20 0.08
21 0.11
22 0.14
23 0.15
24 0.15
25 0.15
26 0.15
27 0.18
28 0.22
29 0.21
30 0.19
31 0.2
32 0.21
33 0.23
34 0.24
35 0.25
36 0.21
37 0.22
38 0.24
39 0.27
40 0.31
41 0.32
42 0.31
43 0.29
44 0.27
45 0.28
46 0.26
47 0.21
48 0.15
49 0.14
50 0.14
51 0.14
52 0.14
53 0.12
54 0.11
55 0.11
56 0.1
57 0.09
58 0.08
59 0.07
60 0.07
61 0.09
62 0.1
63 0.12
64 0.16
65 0.17
66 0.18
67 0.2
68 0.22
69 0.21
70 0.21
71 0.24
72 0.22
73 0.23
74 0.23
75 0.2
76 0.18
77 0.2
78 0.23
79 0.2
80 0.2
81 0.23
82 0.25
83 0.26
84 0.29
85 0.28
86 0.24
87 0.24
88 0.23
89 0.21
90 0.18
91 0.18
92 0.16
93 0.17
94 0.17
95 0.15
96 0.15
97 0.16
98 0.21
99 0.19
100 0.19
101 0.16
102 0.2
103 0.2
104 0.18
105 0.21
106 0.16
107 0.17
108 0.2
109 0.19
110 0.16
111 0.17
112 0.18
113 0.13
114 0.12
115 0.12
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.05
123 0.05
124 0.05
125 0.06
126 0.05
127 0.06
128 0.06
129 0.07
130 0.08
131 0.11
132 0.12
133 0.1
134 0.11
135 0.12
136 0.12
137 0.13
138 0.12
139 0.1
140 0.11
141 0.11
142 0.12
143 0.1
144 0.09
145 0.09
146 0.09
147 0.09
148 0.08
149 0.09
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.07
156 0.09
157 0.1
158 0.1
159 0.11
160 0.13
161 0.13
162 0.13
163 0.15
164 0.13
165 0.18
166 0.18
167 0.18
168 0.2
169 0.26
170 0.32
171 0.31
172 0.31
173 0.26
174 0.3
175 0.31
176 0.28
177 0.24
178 0.27
179 0.28
180 0.29
181 0.3
182 0.25
183 0.24
184 0.23
185 0.23
186 0.14
187 0.13
188 0.12
189 0.11
190 0.11
191 0.1
192 0.1
193 0.08
194 0.09
195 0.13
196 0.11
197 0.13
198 0.14
199 0.16
200 0.16
201 0.17
202 0.18
203 0.15
204 0.17
205 0.18
206 0.17
207 0.17
208 0.21
209 0.21
210 0.22
211 0.22
212 0.25
213 0.3
214 0.36
215 0.41
216 0.47
217 0.56
218 0.64
219 0.73
220 0.78
221 0.81
222 0.87
223 0.9
224 0.9
225 0.91
226 0.9
227 0.88
228 0.85
229 0.84
230 0.84
231 0.79
232 0.72
233 0.71
234 0.73
235 0.67
236 0.64
237 0.63
238 0.59
239 0.59
240 0.56
241 0.52
242 0.5
243 0.52
244 0.52
245 0.43
246 0.38
247 0.32
248 0.32
249 0.26
250 0.18
251 0.18
252 0.14
253 0.16
254 0.16
255 0.16
256 0.17
257 0.18
258 0.21
259 0.22
260 0.3
261 0.32
262 0.37
263 0.38
264 0.38
265 0.4
266 0.37
267 0.31
268 0.24
269 0.2
270 0.15
271 0.16
272 0.16
273 0.14
274 0.17
275 0.18
276 0.19
277 0.22
278 0.22
279 0.22
280 0.22
281 0.23
282 0.19
283 0.18
284 0.16
285 0.15
286 0.17
287 0.19
288 0.23
289 0.27
290 0.28
291 0.29
292 0.31
293 0.31
294 0.28
295 0.26
296 0.21
297 0.2
298 0.2
299 0.2
300 0.22
301 0.22
302 0.23
303 0.21
304 0.2
305 0.16
306 0.16
307 0.17
308 0.12
309 0.11
310 0.1
311 0.12
312 0.17
313 0.19
314 0.23
315 0.22
316 0.25
317 0.27
318 0.29
319 0.28
320 0.26
321 0.25
322 0.2
323 0.19
324 0.18
325 0.16
326 0.15
327 0.14
328 0.12
329 0.11
330 0.11
331 0.1
332 0.09
333 0.08
334 0.06
335 0.05
336 0.06
337 0.06
338 0.07
339 0.09
340 0.09
341 0.1
342 0.1
343 0.15
344 0.14
345 0.16
346 0.16
347 0.16
348 0.16
349 0.15
350 0.16
351 0.12
352 0.13
353 0.11
354 0.11
355 0.1
356 0.12
357 0.13
358 0.16
359 0.16
360 0.15
361 0.2
362 0.22
363 0.3
364 0.36
365 0.42
366 0.46
367 0.49
368 0.5
369 0.47
370 0.46
371 0.43
372 0.37
373 0.32
374 0.28
375 0.26
376 0.26
377 0.28
378 0.26
379 0.22
380 0.19
381 0.2
382 0.2
383 0.22
384 0.22
385 0.19
386 0.2
387 0.25
388 0.28
389 0.26