Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3P229

Protein Details
Accession A0A0C3P229    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MDRLLYRRTRRRKRTSLLVGPVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, extr 4, plas 2
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MDRLLYRRTRRRKRTSLLVGPVLWASCGDEMGFVQEMNEQIDFLPFITAVSSVDGTGGSSGWTARPRDGRIPAAPNCQSAYRLGILDPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.84
5 0.77
6 0.66
7 0.57
8 0.49
9 0.38
10 0.27
11 0.18
12 0.12
13 0.07
14 0.07
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.08
26 0.06
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.07
49 0.11
50 0.12
51 0.16
52 0.22
53 0.26
54 0.32
55 0.37
56 0.4
57 0.41
58 0.47
59 0.48
60 0.51
61 0.49
62 0.45
63 0.42
64 0.38
65 0.34
66 0.29
67 0.28
68 0.21
69 0.2