Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S9W4

Protein Details
Accession A0A0C3S9W4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
128-149FNRADKIIEKTRKKREEKEAAEBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 13, nucl 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039971  CWC24-like  
IPR027370  Znf-RING_euk  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF13445  zf-RING_UBOX  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
PS50089  ZF_RING_2  
CDD cd16539  RING-HC_RNF113A_B  
Amino Acid Sequences MRVGPQRASGSTIRTVTIVDYQPDVCKDYKETGFCGYGDTCKFLHDRGTYLQGWQLDKLAENAQQGGDVSDSDSDEEDIPFACLICRKPYTDPIVTRCGHYFDSACAIRRFAKTPKCAACGAPTGGIFNRADKIIEKTRKKREEKEAAEEDDGDGAPGGVEIEGLAQQRSDDADEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.21
4 0.25
5 0.23
6 0.19
7 0.2
8 0.2
9 0.23
10 0.24
11 0.25
12 0.2
13 0.19
14 0.21
15 0.26
16 0.3
17 0.29
18 0.3
19 0.3
20 0.31
21 0.29
22 0.29
23 0.23
24 0.23
25 0.22
26 0.22
27 0.18
28 0.18
29 0.19
30 0.17
31 0.23
32 0.19
33 0.21
34 0.22
35 0.27
36 0.25
37 0.25
38 0.27
39 0.24
40 0.24
41 0.21
42 0.19
43 0.14
44 0.14
45 0.16
46 0.15
47 0.14
48 0.13
49 0.14
50 0.12
51 0.12
52 0.11
53 0.1
54 0.08
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.05
69 0.05
70 0.06
71 0.08
72 0.12
73 0.13
74 0.14
75 0.16
76 0.22
77 0.27
78 0.3
79 0.32
80 0.32
81 0.37
82 0.35
83 0.35
84 0.3
85 0.27
86 0.23
87 0.21
88 0.18
89 0.12
90 0.17
91 0.17
92 0.19
93 0.17
94 0.18
95 0.2
96 0.22
97 0.25
98 0.27
99 0.33
100 0.35
101 0.42
102 0.45
103 0.45
104 0.44
105 0.42
106 0.38
107 0.34
108 0.31
109 0.25
110 0.2
111 0.19
112 0.18
113 0.2
114 0.17
115 0.14
116 0.15
117 0.13
118 0.14
119 0.13
120 0.2
121 0.26
122 0.36
123 0.44
124 0.52
125 0.63
126 0.72
127 0.78
128 0.81
129 0.82
130 0.83
131 0.8
132 0.8
133 0.76
134 0.7
135 0.63
136 0.54
137 0.44
138 0.34
139 0.28
140 0.19
141 0.12
142 0.08
143 0.06
144 0.06
145 0.05
146 0.04
147 0.04
148 0.03
149 0.04
150 0.07
151 0.08
152 0.08
153 0.08
154 0.08
155 0.09
156 0.11
157 0.12