Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S6Z4

Protein Details
Accession A0A0C3S6Z4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-43KERDRDSDRERDRRDRRDRDVKDRDRERDRBasic
NLS Segment(s)
PositionSequence
24-49RDRRDRRDRDVKDRDRERDRERDRDR
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
Amino Acid Sequences MDVEMKIKDEIDDKERDRDSDRERDRRDRRDRDVKDRDRERDRERDRDRERRDSVAEVTIGSLRSVVAAIVADGRVVGLGRAPASVRLHLADVLAARALVPNRLALVPARAVGTADPQIPSPAHWVVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.4
4 0.41
5 0.44
6 0.46
7 0.49
8 0.55
9 0.57
10 0.63
11 0.71
12 0.76
13 0.79
14 0.83
15 0.82
16 0.82
17 0.83
18 0.84
19 0.84
20 0.85
21 0.83
22 0.83
23 0.82
24 0.8
25 0.77
26 0.78
27 0.73
28 0.73
29 0.7
30 0.71
31 0.68
32 0.71
33 0.71
34 0.74
35 0.74
36 0.73
37 0.7
38 0.63
39 0.59
40 0.51
41 0.44
42 0.36
43 0.29
44 0.19
45 0.17
46 0.14
47 0.12
48 0.09
49 0.07
50 0.05
51 0.05
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.05
70 0.09
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.13
77 0.13
78 0.1
79 0.09
80 0.08
81 0.07
82 0.06
83 0.06
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.11
90 0.11
91 0.12
92 0.1
93 0.13
94 0.13
95 0.13
96 0.14
97 0.12
98 0.13
99 0.12
100 0.15
101 0.15
102 0.16
103 0.15
104 0.15
105 0.18
106 0.18
107 0.19
108 0.2