Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S828

Protein Details
Accession A0A0C3S828    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
73-92RTGRRDTPIEDGRKKKKQRRBasic
NLS Segment(s)
PositionSequence
72-92KRTGRRDTPIEDGRKKKKQRR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011709  DEAD-box_helicase_OB_fold  
Pfam View protein in Pfam  
PF07717  OB_NTP_bind  
Amino Acid Sequences DNQVVGLHPSCGLDAQPEWVIFNEFVLTTRPYIRTVTTVQPEWLLEYAPLYFNLGEFKDSEMKRALIKVQNKRTGRRDTPIEDGRKKKKQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.15
4 0.14
5 0.15
6 0.15
7 0.17
8 0.14
9 0.14
10 0.11
11 0.09
12 0.09
13 0.11
14 0.11
15 0.11
16 0.14
17 0.15
18 0.16
19 0.17
20 0.17
21 0.18
22 0.2
23 0.24
24 0.25
25 0.24
26 0.23
27 0.22
28 0.21
29 0.19
30 0.16
31 0.1
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.08
41 0.08
42 0.08
43 0.08
44 0.1
45 0.17
46 0.17
47 0.19
48 0.2
49 0.21
50 0.21
51 0.23
52 0.26
53 0.26
54 0.35
55 0.43
56 0.5
57 0.58
58 0.62
59 0.68
60 0.7
61 0.73
62 0.7
63 0.67
64 0.65
65 0.6
66 0.65
67 0.66
68 0.67
69 0.66
70 0.71
71 0.73
72 0.76