Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3SCI8

Protein Details
Accession A0A0C3SCI8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-71TTAVRRVTFRRTARRRRSPRPATSAALHydrophilic
NLS Segment(s)
PositionSequence
55-64RTARRRRSPR
Subcellular Location(s) extr 9, mito 8, cyto 4, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLQLRRFRTSGCQLPEEPAHLVWLIPALLIVTTFYSSTCVCNLATTAVRRVTFRRTARRRRSPRPATSAALRVTCRANAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.41
4 0.34
5 0.25
6 0.22
7 0.17
8 0.16
9 0.11
10 0.11
11 0.08
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.06
23 0.07
24 0.08
25 0.08
26 0.09
27 0.08
28 0.08
29 0.08
30 0.09
31 0.11
32 0.11
33 0.14
34 0.16
35 0.17
36 0.18
37 0.2
38 0.24
39 0.31
40 0.37
41 0.45
42 0.53
43 0.63
44 0.73
45 0.82
46 0.86
47 0.87
48 0.91
49 0.9
50 0.89
51 0.87
52 0.81
53 0.75
54 0.71
55 0.67
56 0.59
57 0.54
58 0.46
59 0.4
60 0.37