Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B4UN11

Protein Details
Accession B4UN11    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSETRAPRRKTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
6-23APRRKTTRRKKDPNAPKR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0005634  C:nucleus  
GO:0008301  F:DNA binding, bending  
GO:0006338  P:chromatin remodeling  
GO:0001195  P:maintenance of transcriptional fidelity during transcription elongation by RNA polymerase III  
GO:0070898  P:RNA polymerase III preinitiation complex assembly  
GO:0006366  P:transcription by RNA polymerase II  
KEGG cgr:CAGL0H08541g  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSETRAPRRKTTRRKKDPNAPKRALSAYMFFANENRDIVRSENPDVTFGQIGRLLGERWKALTAEDKQPYEAKAEADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.94
3 0.94
4 0.95
5 0.94
6 0.93
7 0.86
8 0.78
9 0.71
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.2
19 0.18
20 0.17
21 0.15
22 0.12
23 0.11
24 0.11
25 0.13
26 0.16
27 0.17
28 0.18
29 0.21
30 0.21
31 0.21
32 0.2
33 0.2
34 0.16
35 0.13
36 0.12
37 0.09
38 0.09
39 0.08
40 0.09
41 0.08
42 0.1
43 0.11
44 0.1
45 0.1
46 0.12
47 0.11
48 0.11
49 0.18
50 0.2
51 0.27
52 0.32
53 0.31
54 0.32
55 0.34
56 0.34
57 0.3
58 0.27
59 0.21
60 0.25
61 0.33
62 0.37
63 0.41
64 0.44
65 0.44
66 0.5
67 0.53
68 0.5
69 0.48
70 0.48
71 0.5
72 0.49
73 0.51