Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FVX4

Protein Details
Accession Q6FVX4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
162-192FDMRKSMPRDKGKSTRKDGRKHKCYPHDVRFBasic
NLS Segment(s)
PositionSequence
168-183MPRDKGKSTRKDGRKH
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0031416  C:NatB complex  
GO:0004596  F:peptide alpha-N-acetyltransferase activity  
GO:0000001  P:mitochondrion inheritance  
GO:0017196  P:N-terminal peptidyl-methionine acetylation  
GO:0032956  P:regulation of actin cytoskeleton organization  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
KEGG cgr:CAGL0D04796g  -  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
Amino Acid Sequences MTSIDPFEPSDLFQLNNVNLDTLTENFPLEFYLEYLILWPELFFKSNETASNNALYSGYMMAKTEGKGPEWHSHITAVTVAPEFRRISLASRLCNTLEAITDADPHEVNFIDLFVKCNNDLAIKLYEKLGYSVFRRVVGYYNSQKDGYPSSLKKVNDDKDAFDMRKSMPRDKGKSTRKDGRKHKCYPHDVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.21
4 0.2
5 0.17
6 0.16
7 0.17
8 0.17
9 0.14
10 0.16
11 0.14
12 0.14
13 0.13
14 0.14
15 0.12
16 0.11
17 0.1
18 0.07
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.08
25 0.08
26 0.07
27 0.08
28 0.09
29 0.1
30 0.1
31 0.12
32 0.15
33 0.17
34 0.19
35 0.19
36 0.2
37 0.21
38 0.23
39 0.2
40 0.17
41 0.16
42 0.13
43 0.11
44 0.1
45 0.09
46 0.07
47 0.07
48 0.08
49 0.1
50 0.1
51 0.14
52 0.14
53 0.15
54 0.18
55 0.22
56 0.26
57 0.27
58 0.28
59 0.24
60 0.24
61 0.22
62 0.2
63 0.16
64 0.11
65 0.09
66 0.08
67 0.08
68 0.07
69 0.1
70 0.1
71 0.09
72 0.11
73 0.1
74 0.13
75 0.21
76 0.23
77 0.22
78 0.23
79 0.24
80 0.23
81 0.23
82 0.2
83 0.13
84 0.1
85 0.09
86 0.09
87 0.07
88 0.08
89 0.08
90 0.08
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.05
97 0.05
98 0.06
99 0.06
100 0.08
101 0.07
102 0.09
103 0.09
104 0.1
105 0.1
106 0.09
107 0.1
108 0.11
109 0.14
110 0.14
111 0.14
112 0.14
113 0.15
114 0.15
115 0.15
116 0.14
117 0.13
118 0.14
119 0.19
120 0.2
121 0.2
122 0.21
123 0.2
124 0.23
125 0.23
126 0.28
127 0.31
128 0.34
129 0.35
130 0.35
131 0.34
132 0.32
133 0.33
134 0.3
135 0.31
136 0.28
137 0.31
138 0.36
139 0.37
140 0.41
141 0.46
142 0.46
143 0.48
144 0.48
145 0.45
146 0.46
147 0.52
148 0.47
149 0.39
150 0.37
151 0.3
152 0.36
153 0.38
154 0.4
155 0.43
156 0.52
157 0.57
158 0.63
159 0.71
160 0.74
161 0.79
162 0.81
163 0.81
164 0.81
165 0.85
166 0.87
167 0.87
168 0.88
169 0.87
170 0.88
171 0.88
172 0.9