Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FQC5

Protein Details
Accession Q6FQC5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-44SDTSGKLKKSTKRVSKKVKSNKLSEHEHydrophilic
NLS Segment(s)
PositionSequence
23-39KLKKSTKRVSKKVKSNK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0090575  C:RNA polymerase II transcription regulator complex  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0006021  P:inositol biosynthetic process  
GO:0008654  P:phospholipid biosynthetic process  
GO:0010468  P:regulation of gene expression  
KEGG cgr:CAGL0I07359g  -  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
Amino Acid Sequences MKEENISGTETDASNTQSDTSGKLKKSTKRVSKKVKSNKLSEHEVRKNHVVSEQKRREIIRMMYDDLVQIVPDLSQKENRSELAIYIKTANYLRWLYEKNQELRMRIQEKHGDDKEIPQELIWNLKGNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.13
5 0.13
6 0.16
7 0.21
8 0.25
9 0.26
10 0.33
11 0.4
12 0.45
13 0.55
14 0.62
15 0.67
16 0.71
17 0.8
18 0.84
19 0.87
20 0.9
21 0.9
22 0.91
23 0.86
24 0.83
25 0.81
26 0.76
27 0.74
28 0.7
29 0.69
30 0.65
31 0.61
32 0.58
33 0.53
34 0.48
35 0.41
36 0.39
37 0.38
38 0.36
39 0.44
40 0.47
41 0.45
42 0.48
43 0.47
44 0.45
45 0.42
46 0.39
47 0.34
48 0.3
49 0.29
50 0.26
51 0.25
52 0.23
53 0.18
54 0.15
55 0.09
56 0.06
57 0.04
58 0.04
59 0.05
60 0.07
61 0.07
62 0.12
63 0.14
64 0.17
65 0.18
66 0.19
67 0.19
68 0.18
69 0.18
70 0.19
71 0.19
72 0.17
73 0.17
74 0.16
75 0.17
76 0.17
77 0.16
78 0.15
79 0.15
80 0.16
81 0.19
82 0.22
83 0.23
84 0.3
85 0.37
86 0.36
87 0.44
88 0.45
89 0.44
90 0.46
91 0.53
92 0.5
93 0.44
94 0.47
95 0.46
96 0.48
97 0.55
98 0.52
99 0.47
100 0.44
101 0.49
102 0.49
103 0.45
104 0.4
105 0.3
106 0.33
107 0.29
108 0.34
109 0.29