FuNGI

A0A0C3SB98

Protein Details

Accession

A0A0C3SB98

Localization Confidence

High

Confidence Score

19.2

NoLS Segment(s)

Position	Sequence	Protein Nature
22-41	PSFNRALKLRKNEPPPNSRH	Hydrophilic
375-398	PKEKEKFKEKEKLREKPKEKEKFE	Basic

NLS Segment(s)

Position	Sequence
207-207	K
217-238	KARNLAFTKKVPKKPVPPPPAR
281-396	ARKTLAQRKAEKAAAAAQAIAPASGPPPPKAHALPPKPLVPSPSPKKTPVATPSNKRSAPEEPPTKPSPPKRAKASPPPSQTLLPAKVQKSIERPKEKEKFKEKEKLREKPKEKEK

Subcellular Location(s)

nucl 19, cyto_nucl 13.5, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR027093 EAF_fam IPR019194 Tscrpt_elong_fac_Eaf_N
Gene Ontology	GO:0032783 C:super elongation complex GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF09816 EAF

Amino Acid Sequences

MADNTAASWLPARGRFSVTMGPSFNRALKLRKNEPPPNSRHERHYHVLRSDGDSAASFKPSTVDITKPGAVEFHKHEETRIVKVERPSTHTNDETHLFNGRDIPTKDIDCILIFDEDTKTFTLEKVDSIMTVTYDKKIQKEQRAAGSPMPSSGPSTSASSPDSAPLAQTAAKKLAVRAAAEHAEAETRGAEPKAQSTPKLPDEGAKKAPPRVDILNKARNLAFTKKVPKKPVPPPPARIAKEEGEASEGEIVESPRIPPEPVRAPAPTIATASQPVKAGPARKTLAQRKAEKAAAAAQAIAPASGPPPPKAHALPPKPLVPSPSPKKTPVATPSNKRSAPEEPPTKPSPPKRAKASPPPSQTLLPAKVQKSIERPKEKEKFKEKEKLREKPKEKEKFELALPGGPGLSLPGALSAAPKSTSLAFPDSGFVSLPPAPPPIHPPATAAADDDSEEEEWDDVLPTAAPAAAPTPAPPPPQLTLAAPPRMITMEEIEPEPTKYEDQEEEEEEIDEYMFAQELDEHLGEDMSKQDDEEDDFLAAAISPVIESQPMPDERRPLSPPGDVGDGDLWGDEDDSSSSDDSDDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.29
2	0.3
3	0.33
4	0.37
5	0.35
6	0.36
7	0.36
8	0.35
9	0.34
10	0.36
11	0.34
12	0.33
13	0.34
14	0.37
15	0.44
16	0.52
17	0.57
18	0.63
19	0.7
20	0.74
21	0.79
22	0.81
23	0.79
24	0.78
25	0.79
26	0.74
27	0.73
28	0.71
29	0.7
30	0.69
31	0.72
32	0.71
33	0.64
34	0.66
35	0.6
36	0.58
37	0.53
38	0.44
39	0.35
40	0.28
41	0.28
42	0.24
43	0.23
44	0.18
45	0.15
46	0.15
47	0.15
48	0.2
49	0.19
50	0.21
51	0.22
52	0.27
53	0.29
54	0.28
55	0.28
56	0.26
57	0.24
58	0.26
59	0.28
60	0.3
61	0.33
62	0.33
63	0.34
64	0.39
65	0.4
66	0.41
67	0.44
68	0.39
69	0.38
70	0.44
71	0.51
72	0.47
73	0.51
74	0.52
75	0.5
76	0.54
77	0.52
78	0.48
79	0.44
80	0.42
81	0.37
82	0.32
83	0.32
84	0.26
85	0.23
86	0.27
87	0.25
88	0.31
89	0.3
90	0.32
91	0.31
92	0.31
93	0.32
94	0.27
95	0.26
96	0.19
97	0.19
98	0.16
99	0.13
100	0.12
101	0.12
102	0.13
103	0.12
104	0.13
105	0.13
106	0.12
107	0.12
108	0.13
109	0.15
110	0.14
111	0.14
112	0.15
113	0.15
114	0.14
115	0.14
116	0.14
117	0.11
118	0.13
119	0.13
120	0.12
121	0.18
122	0.2
123	0.22
124	0.32
125	0.39
126	0.46
127	0.54
128	0.57
129	0.6
130	0.63
131	0.63
132	0.57
133	0.52
134	0.43
135	0.35
136	0.31
137	0.23
138	0.2
139	0.17
140	0.15
141	0.14
142	0.17
143	0.17
144	0.18
145	0.19
146	0.18
147	0.17
148	0.17
149	0.16
150	0.13
151	0.12
152	0.1
153	0.1
154	0.12
155	0.14
156	0.15
157	0.16
158	0.18
159	0.18
160	0.18
161	0.21
162	0.2
163	0.19
164	0.18
165	0.2
166	0.19
167	0.19
168	0.18
169	0.14
170	0.13
171	0.12
172	0.11
173	0.07
174	0.06
175	0.08
176	0.08
177	0.09
178	0.09
179	0.13
180	0.19
181	0.2
182	0.21
183	0.24
184	0.3
185	0.31
186	0.33
187	0.3
188	0.28
189	0.31
190	0.35
191	0.36
192	0.35
193	0.35
194	0.37
195	0.39
196	0.35
197	0.34
198	0.35
199	0.36
200	0.4
201	0.46
202	0.49
203	0.47
204	0.47
205	0.44
206	0.41
207	0.38
208	0.34
209	0.3
210	0.29
211	0.39
212	0.46
213	0.52
214	0.57
215	0.6
216	0.65
217	0.7
218	0.75
219	0.74
220	0.72
221	0.7
222	0.71
223	0.73
224	0.66
225	0.6
226	0.53
227	0.45
228	0.4
229	0.36
230	0.28
231	0.2
232	0.18
233	0.15
234	0.12
235	0.1
236	0.07
237	0.08
238	0.08
239	0.07
240	0.07
241	0.07
242	0.07
243	0.08
244	0.08
245	0.08
246	0.13
247	0.18
248	0.2
249	0.22
250	0.22
251	0.22
252	0.24
253	0.24
254	0.2
255	0.16
256	0.14
257	0.12
258	0.14
259	0.14
260	0.13
261	0.12
262	0.11
263	0.12
264	0.14
265	0.18
266	0.17
267	0.23
268	0.23
269	0.26
270	0.34
271	0.4
272	0.47
273	0.5
274	0.52
275	0.5
276	0.53
277	0.51
278	0.43
279	0.36
280	0.31
281	0.25
282	0.2
283	0.17
284	0.12
285	0.11
286	0.11
287	0.1
288	0.06
289	0.04
290	0.04
291	0.08
292	0.09
293	0.1
294	0.11
295	0.13
296	0.16
297	0.17
298	0.24
299	0.3
300	0.34
301	0.38
302	0.39
303	0.41
304	0.39
305	0.39
306	0.36
307	0.3
308	0.35
309	0.37
310	0.42
311	0.42
312	0.42
313	0.45
314	0.43
315	0.44
316	0.42
317	0.45
318	0.44
319	0.49
320	0.54
321	0.59
322	0.58
323	0.53
324	0.49
325	0.44
326	0.44
327	0.45
328	0.46
329	0.4
330	0.45
331	0.48
332	0.49
333	0.51
334	0.51
335	0.53
336	0.54
337	0.59
338	0.61
339	0.66
340	0.7
341	0.74
342	0.75
343	0.73
344	0.7
345	0.66
346	0.61
347	0.53
348	0.48
349	0.43
350	0.38
351	0.33
352	0.34
353	0.31
354	0.34
355	0.35
356	0.35
357	0.38
358	0.45
359	0.5
360	0.53
361	0.57
362	0.61
363	0.69
364	0.72
365	0.73
366	0.74
367	0.72
368	0.71
369	0.77
370	0.73
371	0.75
372	0.78
373	0.78
374	0.78
375	0.8
376	0.79
377	0.8
378	0.84
379	0.83
380	0.77
381	0.74
382	0.69
383	0.61
384	0.56
385	0.52
386	0.42
387	0.34
388	0.31
389	0.24
390	0.19
391	0.15
392	0.14
393	0.08
394	0.07
395	0.04
396	0.04
397	0.04
398	0.04
399	0.05
400	0.06
401	0.06
402	0.07
403	0.07
404	0.08
405	0.09
406	0.1
407	0.11
408	0.13
409	0.15
410	0.15
411	0.15
412	0.16
413	0.16
414	0.15
415	0.14
416	0.11
417	0.12
418	0.13
419	0.13
420	0.13
421	0.15
422	0.16
423	0.16
424	0.22
425	0.26
426	0.27
427	0.26
428	0.27
429	0.28
430	0.3
431	0.29
432	0.24
433	0.18
434	0.15
435	0.15
436	0.14
437	0.12
438	0.09
439	0.09
440	0.09
441	0.08
442	0.08
443	0.08
444	0.07
445	0.06
446	0.06
447	0.06
448	0.05
449	0.05
450	0.05
451	0.05
452	0.04
453	0.05
454	0.06
455	0.06
456	0.08
457	0.11
458	0.14
459	0.17
460	0.18
461	0.21
462	0.22
463	0.25
464	0.25
465	0.24
466	0.29
467	0.33
468	0.35
469	0.31
470	0.29
471	0.28
472	0.27
473	0.26
474	0.19
475	0.17
476	0.16
477	0.17
478	0.18
479	0.19
480	0.19
481	0.19
482	0.19
483	0.17
484	0.16
485	0.15
486	0.19
487	0.2
488	0.23
489	0.26
490	0.27
491	0.27
492	0.26
493	0.26
494	0.22
495	0.19
496	0.14
497	0.11
498	0.08
499	0.07
500	0.06
501	0.05
502	0.05
503	0.06
504	0.06
505	0.1
506	0.1
507	0.1
508	0.1
509	0.1
510	0.1
511	0.1
512	0.12
513	0.11
514	0.11
515	0.1
516	0.11
517	0.13
518	0.16
519	0.17
520	0.16
521	0.13
522	0.13
523	0.13
524	0.12
525	0.1
526	0.07
527	0.06
528	0.04
529	0.04
530	0.05
531	0.05
532	0.06
533	0.06
534	0.08
535	0.16
536	0.2
537	0.26
538	0.29
539	0.35
540	0.37
541	0.44
542	0.45
543	0.43
544	0.43
545	0.41
546	0.4
547	0.37
548	0.38
549	0.31
550	0.3
551	0.25
552	0.21
553	0.18
554	0.15
555	0.12
556	0.09
557	0.09
558	0.07
559	0.07
560	0.07
561	0.09
562	0.11
563	0.1
564	0.11

A0A0C3SB98

3D AlphaFold-predicted Structure Viewer