Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3SEK1

Protein Details
Accession A0A0C3SEK1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRRLTKHEESLKTLKQRKKDIHFPIRKYAVKBasic
NLS Segment(s)
PositionSequence
75-116KKKKYTPLDLRPKKTRAIRRRLTKHEESLKTLKQRKKDIHFP
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLTKQLAELKNELLTLRVQKIAGGSASKLTRINTVRKSIARVLTVMNQKARQNLRELYKKKKYTPLDLRPKKTRAIRRRLTKHEESLKTLKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.53
9 0.5
10 0.47
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.16
17 0.15
18 0.17
19 0.17
20 0.17
21 0.16
22 0.16
23 0.16
24 0.16
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.15
33 0.2
34 0.23
35 0.3
36 0.3
37 0.34
38 0.37
39 0.36
40 0.4
41 0.37
42 0.37
43 0.3
44 0.27
45 0.23
46 0.25
47 0.28
48 0.26
49 0.24
50 0.24
51 0.24
52 0.3
53 0.31
54 0.26
55 0.27
56 0.29
57 0.34
58 0.41
59 0.44
60 0.48
61 0.55
62 0.59
63 0.59
64 0.63
65 0.61
66 0.62
67 0.69
68 0.69
69 0.71
70 0.75
71 0.79
72 0.77
73 0.76
74 0.72
75 0.71
76 0.71
77 0.7
78 0.72
79 0.73
80 0.76
81 0.83
82 0.85
83 0.85
84 0.82
85 0.81
86 0.8
87 0.74
88 0.7
89 0.68
90 0.66
91 0.67
92 0.69
93 0.65
94 0.63
95 0.69
96 0.72
97 0.73
98 0.76
99 0.78
100 0.8
101 0.84
102 0.81
103 0.82
104 0.81