Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FUY2

Protein Details
Accession Q6FUY2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKKSSRGPVKRVVQKLDBasic
NLS Segment(s)
PositionSequence
4-10RKKSSRG
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
KEGG cgr:CAGL0E06270g  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRGPVKRVVQKLDTSFNCLFCNHEKSVSCTLDKKNCIGHLSCKICGQSFQTRINSLSQPVDVYSDWFDAVEEVNSGRGSDSEHDNDDENSDSDYESDSDEAAAPQDSDEQEVDSDEDERIGASKRGRGALVDSDEEEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.73
4 0.68
5 0.64
6 0.63
7 0.54
8 0.52
9 0.47
10 0.43
11 0.39
12 0.33
13 0.32
14 0.28
15 0.33
16 0.27
17 0.3
18 0.29
19 0.34
20 0.42
21 0.4
22 0.37
23 0.37
24 0.42
25 0.45
26 0.45
27 0.42
28 0.38
29 0.39
30 0.39
31 0.36
32 0.35
33 0.37
34 0.39
35 0.37
36 0.35
37 0.33
38 0.31
39 0.3
40 0.29
41 0.28
42 0.29
43 0.33
44 0.33
45 0.34
46 0.34
47 0.36
48 0.32
49 0.25
50 0.21
51 0.16
52 0.14
53 0.13
54 0.13
55 0.1
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.06
63 0.07
64 0.05
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.06
73 0.08
74 0.11
75 0.12
76 0.14
77 0.15
78 0.16
79 0.16
80 0.15
81 0.15
82 0.12
83 0.11
84 0.1
85 0.09
86 0.08
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.06
98 0.06
99 0.09
100 0.09
101 0.1
102 0.1
103 0.1
104 0.1
105 0.11
106 0.11
107 0.09
108 0.1
109 0.08
110 0.08
111 0.07
112 0.07
113 0.08
114 0.1
115 0.13
116 0.15
117 0.19
118 0.23
119 0.25
120 0.26
121 0.26
122 0.27
123 0.31
124 0.32
125 0.31
126 0.28
127 0.28